type: prom upgrade arch: elan md5: bc20e810bc00f050cec0cb73ca9a7801 image_size: 491532 prom_version: prom-2.0.1.1 @`<z$`)$z$`%@@p$[%@`<7{[$@`-<@$@#Z$Nz$@#Z$Mz$@#Z$Iz` S-       ✀@ڴD$":̀III%%-<eh<@%<  @$ &+>@x@`@@<A$$ <@A%<A%@`@h<gX<h%<45<45^s=<efX<  @$ &+<efX< e)< eJ +%%)*+ <dB<dc(@@@@ $BC+ <efX<  @$ &+<gZ<d<d$$$<d<d$<eL@@-@$p@%h@'@0-<gX<%----- - (-@0--<gZH4@ <gZ@<@%<H%<0%%$ + xX<dB<A%@@`hp@<A $2<@A $.0D0E+ %< !<A($@<A($@0@@<d@$@ph`XxB@$@0-@8-@ $!H$5)@'诿< e)$ $ @ @!%JK<d<d$$$<d<d$='@< HH$ 5@< HH$ 5@<4< $<4<4<4P<$<4x<#4B$<4<4B@$<4<#4B$<4<4B $<4<#4B$<4 <4B$<4 <#4B$<4(<4B$<4(<#4B$<40$$<48$$<4@$$<4p<4B$<4x<4B$<4$$<4 $$<4܂<4<<<4܂<4<$4B<<4<$<4`<4B$<4h< 4B$<4<F$<4<54B<4BP<4<4B$<4$<4<F<4<4B$<4<4B$<45-@`@ <!@%@`$!H$5)3@@@@(<$/@P@$ B$<$C$$B@<< % @`<@$<@`--(-$ % -@-$ < ek<aX%`$<@I 1)  D<@4 I 4 I 4 xI4 I 4 I 4 I 4 I 4 I4 I4 xI4 I4 I4 I4 I$< H5$$H$HED< 5)H1 !) $H1  1  $H%$d ! B$$d ! 8-<<4< 5JH< 5) @$<  @%H$$`O@- H $ H$ H$$`;@-$`6B $`1 H.$ `*@-@H@P@B" "$ "$ "$ ""  $ ""$ $  - -$!@"@"-$$`Q@- H $ H$ H$?$`;@-$`6B $`1 H.$ `*@-@H@P@B" "$ "$ "$ ""  $ ""$ $ $!@"@"- ---$ @"!--@"$<H $@" $ @" <  < @"<@<@$ @" @ <$@" $<$@"$<4$@%<p$~<p$rx%4p$rx%4p$v@%$ ! $ @",$ 7H%2H%<!p$~<!p$rx%4!p$rx%4!p$vH%<$d ! <4@H-<!p$~<!p$rx%4!p$rx%4!p$vH%$ @"-$ 5H%3H%<!p$~<!p$rx%4!p$rx%4!p$vH%<4$d ! <4 `H-<!p$~<!p$rx%4!p$rx%4!p$vH%< 5JH< 5) @$<  @%H-@x1B$ ' @--1  JB$ *P$ 1  $ 1  I$ +X$ 1  $`-x-<H$ <H$ M$/x<0H$ <  `--@-<* <+<,$<8 <-<.</<9@x1B<(@x1B$ ' -@-@`<@b$<a%@`@<(! !<(! !<(! !<(! ! <(!0!$<* <+<,$<8 <-<.</<9@`@x1B<(< )$ '*3<<< H!$@P'@$%)*H$ @!< < H!$@P'@$%)*H$ @!<$< 1@ H!$@P'@$%)*H$ @!< )$ '*?<<< H!$@P'@$%)*H$ @!< )$ '*< H!$@P'@$%)*H$ @!< @ H!$@P'@$%)*H$  @!< )$ '*9< @ H!$@P'@$%)*H$  @!< H!$@P'@$%)*H$ @!-s@-@`<@b$<a%@`@@<<4@$ <<4@$ @<<4@$ @<<$ <<$ @<(!$ @<<4@$ <* <+<,$<8 <-<.</<9@`@x1B<($ @$ @< @<0@$E<$ $ $ $ @$  @%$  @%<H$ `-x-$  H' @$<H$ --$  H' @$@<< < H!$@P'@$%)*H$ @!<< H!$@P'@$%)*H$ @!<$<@ H!$@P'@$%)*H$ @!< < 1@ H!$@P'@$%)*H$ @!<<< H!$@P'@$%)*H$ @!<$<@ H!$@P'@$%)*H$ @!< < 1@ H!$@P'@$%)*H$ @!< @ H!$@P'@$%)*H$  @!< @ H!$@P'@$%)*H$  @!< H!$@P'@$%)*H$ @!$  H!$@P'@$%)*H$ @!< @ H!$@P'@$%)*H$ @!<$H !)(H$ $$(#$@ H!$@P'@$%)*H$ @!$ $$###п#ȿ#####p#h#P#H#(# ###""""""##"""x"`"X"@"8"(" ""!!!decimal number0tnumoctal number0onumhex number0xnumvalue of symbol&namecontents of register@namecontents of address^addroperators+-*/()recall and execute cmd num!numrecall and execute cmd str!strrepeat last cmd!!delete line from cursor^Kdelete char before cursor^Hdelete char at cursor^Dmove cursor far right^Emove cursor far left^Amove cursor left^Bmove cursor right^Frecall next cmd^Nrecall previous cmd^P break! prompt%d%s Boot Software Version %s, Built %s Processor: %s%d LRRProcessor: (unknown) rev %ld.%ld [0x%04x], %d MHz, (bus: %d MHz), DRAM: hardcoded to 0x%x ::%2d KB DRAM %2d MB DRAM itfailure'v' pressed: /int-flash mount bypassed Error: The boot flash filesystem could not be mounted. init/int-flash/cfg/startup> ESC pressed 'v' pressed: /pc-flash mount bypassed autobootNOTE: power-on tests reported: %s autoboot skipped network disabled nobootdelay'bootdelay' variable invalid, defaulting to 20 seconds bootpBootp in %d seconds - press RETURN to abort and enter prom Autoboot in %d seconds - press RETURN to abort and enter prom (RTC appears invalid, faking delay with %ld loops instead) CHECK AND RESET THE DATE Line too long after expansion Variable syntax Undefined variable %s rptcmdttobad rptcmd value [%s] usage: %s %s %s: Command not found. Type 'h' for help. *%s: command not found %*s %-*s %*s %-*s %s%*s %15s %sThe %s command cannot be invoked by name. I-Cache %d KB, linesize %d. D-Cache %d KB, linesize %d. L2-Cache %d KB, linesize %d, L2-Cache %d MB, linesize %d, cache %s. enableddisabledL3-Cache %d KB, linesize %d, L3-Cache %d MB, linesize %d, searching.. %s: neither hex value nor symbol **`*X*(set the MAC address (format: aabbcc:ddeeff)-mset the board id (MLS1000 = 1)-iBoard ID = %ld MAC Address = %02x%02x%02x:%02x%02x%02x %ldfailed to write board id sts = %d sysid%02x%02x%02x:%02x%02x%02xfailed to write MAC bytes 0 and 1 failed to write MAC bytes 2 and 3 failed to write MAC bytes 4 and 5 %02x:%02x:%02x:%02x:%02x:%02xethaddrRebooting. . . traborttr: error: trabort not set hostporttty0can't use tty0 as hostport in transparent mode can't open %s Entering transparent mode, %s to abort --,,,ؿ,п,ȿ,,,quit.back one^|-re-read=forward one, no changeCRset memory, forward onehexval-sbad arg count %08lx %02x .-------pdo it in 64 bit mode to cached region-cdo it in 64 bit mode-p32 bit hexadecimal valuevaladdress to modifyadr..address to display%08lx: %08lx %08lx: swapped: %08lx 'to' address too small %s%c: unknown option Function address not specified Function returns: 0x%x (%d) */..flush D-cache-dflush I-cache%c: bad option %s: bad argument ///p/Psend dump to host -hdump binary image-BBh:can't dump binary to tty uleofulcrcr lf S3%02lX%08lX%02X%02X%sS70500000000FA%s1000п0ȿ0- 000hdisplay as register-rdisplay a null terminated stringdisplay as words-wdisplay as half-words-hdisplay as bytes-bdatasz%s: bad datasz value %s: unknown argument address not specified %s %s: bad register name BԀBBBBBB̀BBBBBBBBBBB܀BBBB%08lx %02x %04x %08lx %016llx +-*/divide by zero %s: bad indirect address epc%s: bad symbol name inbase%s: bad inbase value %s: bad base %s value inalpha%s: bad inalpha value id23bad option '%s' rVpI-Cache: (4-way, index=0..127, 32b per line) %3d: !b0x%08x, , D-Cache: (4-way, index=0..127, 32b per line) DcL2-Cache: (4-way, index=0..2047, 32b per line) 5p5h5`5X5P5H5@58505(5 555544444ؿ4п4ȿ4444444444xras8spgpk1k0t9t8s7s6s5s4s3s2s1s0t7t6t5t4t3t2t1t0a3a2a1a0v1v0atzero6666ؿ6п6ȿ6666666666x6p6h6`6X6P6H6@68606(6 66665$31$30$29$28$27$26$25$24$23$22$21$20$19$18$17$16$15$14$13$12$11$10$9$8$7$6$5$4$3$2$1$0888888x8h68X8H888(8 888777п76P6H6@68606(77777x5C0_ERRPCC0_TAGHIC0_TAGLOC0_CACHERRC0_ECCC0_WATCHHIC0_WATCHLOC0_LLADDRC0_CONFIGC0_PRIDC0_EPCC0_CAUSEC0_SRC0_COMPAREC0_TLBHIC0_COUNTC0_BADADDRC0_WIREDC0_PGMASKC0_CTEXTC0_TLBLO1C0_TLBLO0C0_RANDC0_INX:@:8:0:(: ::::99999ؿ9п9ȿ9999999999x9p9h9`9X9P9H$f31$f30$f29$f28$f27$f26$f25$f24$f23$f22$f21$f20$f19$f18$f17$f16$f15$f14$f13$f12$f11$f10$f9$f8$f7$f6$f5$f4$f3$f2$f1$f0::::::hlist trace buffer-tlist only calls-clist only branches-b%c: unknown option %s: unknown option regstyle%08lx: illegal instruction address %s%08lx %08lx ,0x%lx# %d%lx# 0x%08x%ld()# 0x%x%ld, # ]܀Y`__cZ`^h^`Ԁa@a^b|Z8[]l[4YZZa[P[\X\ab bDcX`XYD[]`|cX !%s %s: Event not found. %5d %s addhist: out of memory UPUH$UH4U@!U8"U0#U(-U .U/U'UUUT T T$T!T,T`TdT-T$T0TATETITMTATETxITpMThAT`ETXITPMTHAT@ET8IT0MT(T TTTPTTSXS\SSSSSSSSS? $S%S@@SD@SH@SL@SxBSpBShBS`BSXBSPBSHBS@?FS8?F S0?FS(?F S ?FS?F S?FS?F S?F R?F  R?F R?F  R?F R?F  R?F  R?F R?F0!R?F 0!R?F1!R?F 1!R?F2!R?F 2!R?F3!R?F 3!R?F4!Rx?F 4!Rp?F5!Rh?F 5!R`?F6!RX?F 6!RP?F7!RH?F 7!R@?F8!R8?F 8!R(?F9!R?F 9!R?F:!R?F :!R?F;!Q?F ;!Q?F<!Q?F <!Q?F=!Q?F =!Q?F>!Q?F >!Q?F?!Q?F ?!Q?F Q?F Q?F Q?F! Q?F! Q?F! Q?F $ Qx?F$ Qp?F % Qh?F% QX?F QH?F Q8?F  Q(?F Q?F Q?F P?F  P?F P?F  P?F P?F P?F P?F P?F Px?F Ph?F P`FPXJPPNPH@P@DP8HP0LP( P  P P P P O OO<OOOOOOOOOhOOOOOxOpOhO`OXOP@OHDO@HO8LO0@ O(D O H OL O@ODOHNLN@NDNHNLNNN N N N N N N'N%N4NxNpNhN`NXNPNHN@N8N0N(N NNNN? MM?8 MM<M*M(M,M+M? MM?; MM?M? MM?: MxMp>Mh"M`#MX.MP/MH M@?4 M8M0?0 M( M ?1 M M?2 M M?3 LL?6 LL L&L8L.wordxorixorsyscallsynctnetneitltutltiutlttltitgeutgeiutgetgeiteqteqidsubudsubsubusubdsrl32dsrlvdsrlsrlvsrldsra32dsravdsrasravsrasltusltiusltisltdsll32dsllvdsllsllvsllsdsdc2sdc1scdswc3swc2swc1scswrsdrsdlswswlshsboriornordmultudmultmultumultmtlomthimflomfhidmtc3dmtc2dmtc1dmtc0mtc3mtc2mtc1mtc0dmfc3dmfc2dmfc1dmfc0mfc3mfc2mfc1mfc0ldldc2ldc1lldlwc3lwc2lwc1llldrldllwulwrlwllwlhulhlbulbluijrjalrjaljddivuddivdivudivctc3ctc2ctc1ctc0cop3cop2cop1trunc.w.strunc.w.dtrunc.l.strunc.l.dround.w.sround.w.dround.l.sround.l.dfloor.w.sfloor.w.dfloor.l.sfloor.l.dceil.w.sceil.w.dceil.l.sceil.l.dcvt.l.scvt.l.dcvt.w.scvt.w.dcvt.d.lcvt.d.wcvt.d.scvt.s.dcvt.s.lcvt.s.wc.ngt.dc.ngt.sc.le.dc.le.sc.nge.dc.nge.sc.lt.dc.lt.sc.ngl.dc.ngl.sc.seq.dc.seq.sc.ngle.dc.ngle.sc.sf.dc.sf.sc.ule.dc.ule.sc.ole.dc.ole.sc.ult.dc.ult.sc.olt.dc.olt.sc.ueq.dc.ueq.sc.eq.dc.eq.sc.un.dc.un.sc.f.dc.f.ssqrt.ssqrt.dneg.dneg.smov.dmov.sabs.dabs.sdiv.ddiv.smul.dmul.ssub.dsub.sadd.dadd.scop0eretrfetlbwrtlbwitlbrtlbpcfc3cfc2cfc1cfc0cachebreakbgezallbltzallbgezalbltzalbgezlbltzlbgezbltzbgtzlblezlbnelbeqlbgtzblezbnebeqbc3tlbc2tlbc1tlbc0tlbc3flbc2flbc1flbc0flbc3tbc2tbc1tbc0tbc3fbc2fbc1fbc0fandianddaddudaddiudaddidaddadduaddiuaddiaddbalbnotdnegudnegdmovenegunegmovelinopslslslstststststslslststststststststststslt(t(t(ttttttLtptttttttttttpVVVؿVVVVxV`VXV8display all fp registersf*set specified fieldreg field valueset specified registerreg valuedisplay all registers starting with tt*display all registers*regsizeerror: arg2 [%s] bad register name Register is readonly warning: 0x%016llx is an invalid 32-bit value error: arg3: [%s] bad field name error: arg4: [%s] bad symbolic value error: arg%d: [%s] base %d value expected error: arg%d: [%s] max value %d expected %*s=WRTEONLY %*s=%s=%08lx %*s=%s=%016llx %*s=%016llx %*s=%08lx %s $%02d- %016llx %08lxdisp_reg: spec==0 %*s: T`$f%-2ld = %08lx/%08lx sp=0.0 (denorm) sp=%e dp=0.0 (denorm)dp=%eC1_CSRC1_FRIDdp=0.0 (denorm) dp=%e bad register number bad arg count $%s-: %016llx : %08lx %s%*.*s +0x%-4lxout of memory Not enough memory to sort symbols, sorry 0x%08lx = 0t%ld = 0o%lo %08lx: not found %08lx = %s %08lx %s[0[ [[[ZZZlookup address-acompute value-vnumeric order-nlong listing-lbad option [%c] no values specified *Pmon_ftextstartetext$Header: /import/software/cvsroot/boot/prom/pmon/algcommon/nvram.h,v 1.8 1998/06/04 11:35:18 warner Exp $bbbbbbxbpb`bPbHb@b8b0bbaaaaaaaaaaapaa`aPaHaa8a0a aaa````ؿ```(``````x`p`h```X`H`@`8`0`(````___a__пbp______x_h_`_P_H_8_0_ __^link:/pc-flash/boot/bootsourcebootsource5bootptimeoutbootautoboot2bootdelay86400mfg_loop_maxtime counttimemfg_loop_bydiag_logoff on quick mfg-testbootdiagmode9600tty0_ftext etextvalidpc%uleofcr lf crlflfulcr^Ktrabortoff on tracetracerptcmd32 6432regsizehw swswregstylers-boot> prompt24moreszauto 8 10 1616inbasehex symbolhexinalphatty1hostportreboot debugrebootcrashactiongateway(unknown).comlocaldomainnameserverbootaddrnetmask0.0.0.0netaddr0sysid (ethaddr is base MAC addr, add one for actual CPU MAC address)00:e0:63:00:00:01ethaddrnone XonXoff EtxAckEtxAckdlprotooff ononflow_controloff on lfeedoffdlecho-b -h -w -d-bdataszl @epc 1brkcmd%s: bad %s value, try [%s] %s: not found %s: cannot set variable promsetaddrs1dec0%s=%s: no matching variable %10s%10s = "%s"%10s = %-10s [%s]%sInvalid value '%s' for environment variable '%s' Baud rate %d too large, max. value is 38400 Illegal baud rate %d baudterminalsetsystempoweron-selftestbootpromlocal-domaintftp-servertftp-gatewayError: Config file could not be opened, error = %ld error: Out of memory for config file Error: Could not open config file, error=%ld Error: Could not read config file, error=%ld Error: Read %ld bytes of config file instead of %ld bytes Console baud rate modified to %d Error: stty(tty0), error setting baud to %s Error: Setting baud environment variable Boot prom's network address modified: %s Boot prom's network mask modified: %s Boot prom's name server modified: %s Boot prom's TFTP server modified: %s Boot prom's local domain name modified: %s Boot prom's gateway modified: %s Power-on self test mode: %s mfg-testPower-on self test mode was %s, now %s quickPower-on self test mode was %s, now off Boot prom's TFTP is being user disabled. . . NVRAM dump: (%d bytes) 0x%03x: %02x 3840019200960048002400180012006003001502001341107550jiiiȿiiiiiipihi@i8iihhhdisable tandem mode-ixoffenable tandem modeixoffallow only to restart output-ixanyallow any char to restart outputixanyset sane settingssaneset terminal typeset baud ratelist all settings-alist possible baud rates and terminal types-v%s: unrecognized baud rate tty?can't open %s term type %s not found Baud rates: %5s Terminal types: %10s term=%s baud=%s%sistrip -%sixon %sixany %sixoff %sicanon %secho %sechoe %sicrnl %sonlcr erase=%s stop=%s start=%s eol=%s eol2=%s vintr=%s |/-\more... k%s: invalid moresz value lllxl`lXlHl@l0l(l quitqnext lineCRnext pageSPACErepeat last searchnsearch for str/str %s %snq/ /%s %c %cnxn`nXn@n8n nmmmпmȿmmmmmpmhmXmHm0load from -hset baud rate-uload offset-oignore checksum errors-iload at top of memory-tdon't add offset to symbols-adon't clear exception handlers-edon't clear breakpoints-bdon't clear symbols-ssend cmdstr to host-c cmdstrout of symbol spacebad checksumbad typebad lengthbad charbeastic:u:o:h:hostportrcan't open %s dlprotodlecho%s: unrecognized baud rate Downloading from %s, ^C to abort unknown record type %d errors %3d %s total = 0x%x bytes ؀Ȁ8Ѐ8888888 888Entry address is %08lx bad termination record Entry Address = %08lx p<ϔ,؀Xqqqqpq`qPq@q(qpargs to be passed to client-- temporary breakpoint-b start address-e time execution-tdon't set client sp-s b:e:sttime s(ssrrrȿrrrrrprXrHr0r rstop on reg not equal-R reg valstop on reg equal-r reg valstop on mem not equal-M adr valstop on mem equal-m adr valstop on pc invalid-icapture only calls (jal)-ccapture only branches-bverbose, list each step-vtobad arg count MEMORY%s: bad reg name %c: unrecognized option %s: unrecognized argument stopval table full t`tHt@t tsqscommand stringhw bpt for data write only-whw bpt for data read only-rhw bpt for data access-dno hardware breakpoint on R4600Bpt %2d = %08lx too many breakpoints Bpt %2ld = %08lx -> ?? "%s"break address not specified Bpt %2d = %08lx Bpt %2d = %08lx %s [ read write ] *%s: decimal number expected Bpt %2ld not set %ld: breakpoint number too large ruuPcurrent Status: %08x new SP: %08x %08x: %02x %s PMON %s exception Cause: %08x EPC: %08x RA: %08x BadVa: %08x DTTTDTTTDTTTDTTTD %s Interrupt Exception Cause=%s Unexpected Breakpoint Stopped at H/w Bpt %d Stopped at Bpt %d Stopped: Invalid PC value == != Stopped: 0x%08lx%s0x%08lx Stopped: %s%s0x%08lx %s brkcmdvalidpc variable must have even number of values validpcregsizevinvalid SP=0x%lx invalid PC=0x%lx 0x%08lx+0x%-4lx 0x%08lx0x%llx0x%lx from frame=0x%08lx size=%-4d (alloca=%-4d)stacktrace loop!<x܀܀܀܀xddhhԀԀԀԀԀԀclient finished normally. No return status available. Attempting to return to monitor. Don't hesitate to 'reboot' if the monitor appears confused. |(||{{{ؿ{ȿ{{{xargs to be passed to client-- port to communicate with host-h verbose mode-Vreport protocol errors-vdon't set client sp-s hostportvVsh:hostport=%s can't open %s hostfd=%d 0x1 %c 0x0 0x%xȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀĀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀPutMsg: got type=%s seq=%d, wanted type=ACK seq=%d ACKDATA GetMsg: got type=%s seq=%d msg=<%s>, wanted type=DATA seq=%d PutPkt: seq=%d msg=<%s> xph`XENDCSUM3CSUM2CSUM1MSGSEQLEN2TYPLEN1STARTGetPkt: state %s, timeout GetPkt: state %s, restart GetPkt: bad length %d GetPkt: csum error tx=%x rx=%x GetPkt: seq=%d type=%s msg=<%s> GetPkt: state %s, bad char=0x%x <t܀   dlt|ac=%d: av[%d]=%s %s %s 0x%x 0x%lx%s %s 0x0 0x%llx%s %s 0x0 0x%lxunknown request type '%s %s %s %s' %s %s 0x%x 0x0 88  \ 888888 Ȁ8 l8 (88888888888888 88 | 888888 `8 ܀ 888 80( RMRPRZRNXPH@80 (     SISUSOSZSVTITUTOTZTVEIEUEOEZEVEECFSx????usersupvkern(xph`XPH@80`( IEEXLERLKSUUXSXKXIM&SWDECECHSRTSBEVREFRCUxph`XPH@88888808888888(VCEDWATCHResvCp2FPEVCEITrapOvfCpURIBpSysDBEIBEAdESAdELTLBSTLBLMODIntX`  PH@EXCODESWIPBD  RevIMP DxxxDxxxDDxxxxxDxxDxxDDxxxxDDxxxDxDxDDxxDDxDDxph`XPresvupdexc/wexclnonctuncdwt/awt/na  Hx ph`X P H @ 8 0( (K0DBIBDCICSEEBEMBESMSCEWSSSBEPECCM  ASIDVPN2P(xpGVDPFNܰh`ܸXPH@80( ؿȿ (xp0h`8XP@H@H80P( X`hpxؿ݀ȿ݈ݐݘݠݨxphhݸ``ݰXpпȿH@`80( ߈X`ȿPhpxph߀XP@@88@8(0(пߐ xHh`@XP`H@FRIDC1_FRIDCSRC1_CSRCONFIGC0_CONFIGRANDOMC0_RANDOMINDEXC0_INDEXXCONTEXTC0_XCONTEXTCONTEXTC0_CONTEXTENTRYHIC0_ENTRYHIENTRYLO1C0_ENTRYLO1ENTRYLO0C0_ENTRYLO0PGMASKC0_PGMASKTAGHIC0_TAGHITAGLOC0_TAGLOCACHERRC0_CACHERRECCC0_ECCLLADDRC0_LLADDRWATCHHIC0_WATCHHIWATCHLOC0_WATCHLOERRPCC0_ERRPCBADVAC0_BADVAEPCC0_EPCPRIDC0_PRIDCAUSEC0_CAUSEC0_SRLOHI31ra30s829sp28gp27k126k025t924t823s722s621s520s419s318s217s116s015t714t613t512t411t310t29t18t07a36a25a14a03v12v01at0zerocontinuous test-c%c: bad option %s: Unknown argument Testing %08lx to %08lx %s continuousMemory test running..  There were %d errors.  Test passed with no errors.  error: addr=%08x read=%08x expected=%08x  error: adr=%08x read=%08x expected=%08x 0x%08lx-0x%08lx: %s xp0(0x, default 0x80000000+memsize (16M -> 0x1000000)-e0x, default 1M (0x100000), should be (1 << n)-b0x, default 0x80000000-sbad arg count %s is an invalid address (try 0x12ab) '%s' is an invalid option startaddr is greater than endaddr freeing previous block at 0x%08x (size %d) unable to allocate memory 0x%08lx (size 0x%x) : %s slot %d ('%s') is out of range. Try 1 through 4 (5=nia packet mem) allocalloc must specify a freeslot %d wasn't allocated testslot %d wasn't allocated. Allocating slot %d with 0x10000 bytes. 0x%08lx (size 0x%x) : %s [recorded] 0x%08lx (size 0x%x) : %s [computed] results differ.. computing block by block differences 0x%08lx was: %02x 0x%08lx now: results are the same. Memory is intact Usage: allocmemtest alloc allocmemtest test allocmemtest free foo_cmd: argv[%d]=%s "xcx`mX@,x00c(-H2c؀3п.4|c5hVPuH008 A:HS@Fcx6cphP-H0<؀п<xcp`Hc@(.d؀{cпhc.п;<hpXP0ȿ h8^hV`H6@0$(cƘpcƘxcph!0`&cXhkH&c@8 e8fPghؿijpX}P@m8 n8n؀qtпy`hr,xhPzPH8( h؀rȿ{hp|`hH$8h MPؿ**4h-hpt`hP@h0X(hؿhhcPhx phXpcdiag commands[cmd]diagshow hardwarehardwareenable NILE interruptsnileintsdump nvram contentsnvramdumpreceive packetssumshow/set PHY registers[addr [data]]mdioshow dec statusdec_statussend packetsend_packetinitialize decchipinit_decchiprebootset/show board ID + MAC[-i boardid] [-m macaddr]newsystemset or show idprom dataset|show [addr] [data]idpromconvert pc-flash VFS 2pcmakeversion2convert pc-flash VFS 1pcmakeversion1show ver of pc-flash VFSpcshowversionerase pc-flash[-f][slot0|slot1]erasepcvfserase internal-flasherasevfsunpack tarfile untarcopy files cpunmount pc-flash[slot0|slot1]pcumountunmount internal-flashumountmount pc-flash[-i][slot0|slot1]pcmountmount internal-flash-imountset current directorycdprint current directorypwddelete filermdisplay PC-flash block[slot0|slot1]pcshowblockshow contents of filecatcreate empty filetouchlist directory[]lsremove directoryrmdircreate directorymkdirpaginatormorecommand shellshboot from bootp server[-pdvnbk] [kernel-args]bootpboot from file[-pdvnbk] filespec [kernel-args]bootping remote host[-fqrv] [-c cnt] [-s sz] hostpingload file with tftp[-bens] [[host:]file]loadtest Elan hw features[fpga[reg[val]]]][nia_sram]elanoperate PCMCIA[poll, vppon, off, see_common, see_attribute, 0, 1]pcmciatest memory refreshallocmemtestmemory md5sum[-s start][-b block][-e end]memsummemory test[-c][[addr] size]mtflush caches[-di]flushset terminal options[device] [opts]sttygdb-remote debug mode[-vv][-h port][-- args]debugget/set date and time[[yy]yymmddhhmm[.ss]]dateedit variable(s)name ...esetunset variable(s)name* ...unsetdisplay/set variable[name [value]]setdump memory to net hosthost startaddr kb startpagenetdumpdump memory to hostport[-B] adr siz [port]dumptransparent modetrsearch memorysearchfill memoryfrom to {val|-s str}..fillcopy memoryfrom to sizcopydisassemble memory[-bct][adr [cnt]]ldisplay memory[-bhws] adr [cnt]ddisplay/set register[reg* [val|field val]]rdisplay swab32'ed worddswdisplay word[-p [-c [-s]]] adrdwmodify swab32'ed wordaddrmswmodify word[-p [-c]] adr valmwmodify memory[adr [val|-s str]..]mdisplay command history[cnt]hion-line help[*|cmd..]hHardware inventory: %&&<&,&% tty0 Warning: Setting environment baud rate from %s to %s microtime: count=%u compare=%u $Header: /import/software/cvsroot/boot/prom/pmon/algcommon/nvram.h,v 1.8 1998/06/04 11:35:18 warner Exp $(ހMȀv4~@\gU(ހ$(ހ'(ހ'(ހ(ހ'(ހ'(ހ(ހ&;(ހ'(ހ'(ހ(ހ'(ހ'(ހxphSatFriThuWedTueMonSun( ؿDecNovOctSepAugJulJunMayAprMarFebJanbad seconds bad minutes bad hours bad day bad month bad year %s: bad date syntax weekday was %d (not 1..7) BluesDaymonth was %d (not 1..12) %s %04.4d-%02.2d-%02.2d %02d:%02d:%02d $Header: /import/software/cvsroot/boot/prom/pmon/algcommon/nvram.h,v 1.8 1998/06/04 11:35:18 warner Exp $Error: NVRAM was uninitialised Error: NVRAM had an unrecoverable checksum error Warning: NVRAM had a recoverable checksum error Warning: NVRAM had bad state (%d) ethaddr%02x:%02x:%02x:%02x:%02x:%02xfailed to write MAC bytes 0 and 1 failed to write MAC bytes 2 and 3 failed to write MAC bytes 4 and 5 sysid%ldfailed to write board id sts = %d sbd_mapenv: runaway loop (ހMȀv4~@\gU(ހ$(ހ'(ހ'(ހ(ހ'(ހ'(ހ(ހ&;(ހ'(ހ'(ހ(ހ'(ހ'(ހ$Header: /import/software/cvsroot/boot/prom/pmon/algcommon/nvram.h,v 1.8 1998/06/04 11:35:18 warner Exp $(ހMȀv4~@\gU(ހ$(ހ'(ހ'(ހ(ހ'(ހ'(ހ(ހ&;(ހ'(ހ'(ހ(ހ'(ހ'(ހElan %s=%04x.%04x%s interruptCache Error exceptionPMON %s exceptionCauseEPCRABadVaddrCacheErrIDIdIdIdIDIdIdIdIDIdIdIdIDIdIdIdIDIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIdIT cop1 called IJ@J@J@J@J@JJ@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J@J J@J@J(J@J@J@J0J8Index %2d: tlbHi: 0x%lx PageMask=0x%lx VPN2=0x%lx ASID=0x%lx tlbLo0: PFN=0x%lx C=%ld D=%d V=%d G=%d tlbLo1: PFN=0x%lx C=%ld D=%d V=%d G=%d showaddress %s was not numeric (using non-recommended address %d address %d is out of range (use 0-63) idprom[%d] == 0x%04x setdata %s was not numeric (using non-recommended address %d) idprom[%d] = 0x%04x: write failed idprom[%d] = 0x%04x: write succeeded DIMM slot 0 (back): empty %d MB (type %d) DIMM slot 1 (front): %d MB DIMM in slot0 limited to 256 MB. %d MB DIMM in slot1 limited to 256 MB. DIMM memory cards incompatable! DIMM in slot1 disabled.  error: addr=%08x read=%08x expected=%08x brd_det[7:1], 0hotswap_req[7:1], 0ch_addr[3:0], hw_stat=0,temp,fan,powerbrd_rst_l[7:1], bkp_rst_lled_l[7:1], 0stat_led=ok,hb,err,runmodule_id[4:0], warm_reset, cur_mstr, mstr_req_l0, bkp_id[2:0], int_status=nia,stat,hotswap,brd_detint_mask[3:0]spare_[3:1], cpu_osc2_en, jmp4, jmp3, jmp2, jmp1fpga version id HhxȿHnia_sramTesting NIA SRAM.... Iteration #%d %d errors found! fpgaElan FPGA register dump: reg[%d]=%02x %s reg[%d]=%02x reg[%d] now = %02x spdElan DIMM SPD memory dump: Couldn't read DIMM%d, SPD byte %d DIMM%d, SPD byte %d = %d, 0x%x 16-bit card not detected in slot %d!! 16-bit 3V card detected, but not supported in this driver. Enabling 5V Power and 16bit outputs Card %d now activated. Card in slot %d deactivated. Error. PCI1220 IIC interface not detected. PCI1220 IIC interface broken! vpponSetting VPP on active slot %d offSetting VCC/VPP off see_commonSlot %d common memory visible at 0x%08x see_attributeSlot %d attribute memory visible at 0x%08x 01memDIMM%d has %d components: %dMb, x%d ORG, %d banks, %d cols, %d rows. DIMM%d has %d physical banks. Only 1 bank supported by NILE. DIMM%d supports ECC/parity. DIMM%d total accessible memsize: %dMB. DIMM in slot %d not found. pollSocket %d status [%lx] = 0x%lx 16-bit card not detected in slot %d 16-bit 5V card detected Valid cards found in both sockets, using card in socket 0 intctrl now=%08x intctrl+4 now=%08x intppes now=%08x enabled timer 2 %c0123456789abcdefgdb receive: %s gdb receive: bad ack from host gdb receive: good ack from host gdb send: $%s gdb sending: finished transmission, waiting for ack gdb sending: got ack p p`pԀpԀq qDq|qrrrrrrrrrqĀrrq qDq|qpppprrrrrrrrrrrrppppclient halted, exception_code=%d, epc is %lx tuuuuuuuuuuuuuuuuuuuuuuutuuutuuuu uuutuuutuuutuuutuuutuuuuuuutOKE00E01E02v`z܀z܀z܀z܀zĀz܀z܀vz܀z܀z܀z܀z܀xz܀z܀vԀz܀z܀z܀z܀z܀z܀z܀z܀z܀z܀z܀z܀z܀z܀z܀z܀z܀z܀zz܀z܀z܀vz܀z܀z܀z܀z܀wlz܀z܀z܀z܀z܀zabout to continue/step, epc = %lx prom_exception_vector=0x%lx ramtop=0x%lx debug=prom tty0_baud=%dtty1 tty1_baud=%s hostportvVsh:client args: <%s> hostport=%s can't open %s debugfd=%d to allow segfaults: set {int}0x%lx = 47 ; set {int}0x%lx = ~47 passing control to prom-based remote debugger execute 'target remote ' on your host gdb now debugging client finished normally. You should 'detach' from gdb now. gdb may indicate a 'SIGINT' right now. Don't believe it. Detach! hH@ @ؿпǰǨǘǐxpXP argv's passed to the main imagekernel-argsskip webdata and images [tftp boot only]-kbypass image checksum-bload but do not run-nverbose mode-vrun under runtime gdb debugger-drun under prom gdb debugger-p or file:/pc-flash0/file or file:/pc-flash0/dir/tftp://host.com/filenamefilespec[,...]bkdpnzvtftp://tftp://bootaddrmissing host address and $bootaddr not set /bootsource=Source string '%s' is too long to be passed to the runtime, dropping it source: %s warning: couldn't unmount webdata vfs unmountwarning: couldn't unmount images vfs Kernel not found or lost in transmission Warning: checksumming bypassed. Kernel is unvalidated md5sumversion file didn't have an 'md5sum' entry version file's md5sum was invalid Kernel checksum didn't match that of the version file: image was corrupted during transmission. Kernel invalid. Please boot again. Image checksum validated Warning: no checksum found in version file - kernel is unvalidated boot_version_addr=0x%xboot_version_addr=0x%lxboot_webdata_vfs_ramdisk_addr=0x%xboot_webdata_vfs_ramdisk_addr=0x%lxboot_webdata_vfs_ramdisk_blocks=%dboot_images_vfs_ramdisk_addr=0x%xboot_images_vfs_ramdisk_addr=0x%lxboot_images_vfs_ramdisk_blocks=%dramtop=0x%xdebug=runtimedebug_verbose=%dtty0_baud=%dpromversion=%sExtMemAddr=0x%lxExtMemSize=%d MBclient args: %s flushing webdata ramdiskflushing images ramdiskUm, something went wrong and the file wasn't run |񁠀\񁠀񁠀񁠀񁠀񁠀񁠀񀘀񁠀񁠀l񁠀T񁠀񁠀񁠀񁠀񁠀d񁠀񁠀񁠀 short read/short file (read %d, expecting %d) short read (read %d, blocksize %d) Build Host Build location: host '%s' Build Userby '%s' Official Version Version: %s Build Date Build date: %s webdata_vfs_blocks warning, 'webdata_vfs_blocks' was invalid '%s' warning, webdata VFS defaulted to %d blocks, but version file calls for %d images_vfs_blocks warning, 'images_vfs_blocks' was invalid '%s' warning, images VFS defaulted to %d blocks, Loading kernel bad ELF header for 'kernel'.. not an ELF file? Wrong architecture? non-executable ELF file (no program header) too many ELF program segments corrupt ELF file: program header lies beyond end of kernel (base 0x%x, size %d) ELF file corrupted: segment %d attempts to load beyond real memory problem: segment %d starts at %d, before segment %d at %d  %3d%%%4dk 100%% - kernel loaded /tftp-webdatacreating directory unable to create %s touching ramdisk file unable to touch %s creating ramdisk filewriting to VFS file/tftp-images File: %s (%d bytes) File: %s versionkernelwebdata/images/ %s: unknown file, ignoring error, no memory to create webdata filesystem creating webdata ramdiskerror, no memory to create images filesystem creating images ramdisklink:using link: bootsource /pc-flash0/boot/bootsource/pc-flash1/boot/bootsource/pc-flash/link pointed at %s linkfile didn't exist, looking for single /boot/ directory /pc-flash0/bootfile:/pc-flash/boot/%s/single directory %s found no suitable image found in slot 0 /pc-flash1/bootfile:/pc-flash1/boot/%s/no suitable image found in slot 1 file:bootsource,All bootsources failed. 255.255.255.25500:00:00:00:00:00ethaddrBOOTPD Ethernet Base address = %s Ethernet CPU address = %02x:%02x:%02x:%02x:%02x:%02x bootptimeout'bootptimeout' variable invalid, defaulting to 5 seconds Performing Bootp with timeout in %d seconds. Booting boot file %s. Aborting boot. Rebooting bootprom. . . bkdpnzvfile:Error: source '%s' must begin with 'file:' Error: pathname '%s' must begin with a '/' -vbootsource=Source string '%s' is too long to be passed to the runtime, dropping it source: %s Error: couldn't load ELF file '%s' versionError: couldn't read 'version' file in %s, error=%ld Error: out of memory for version file Error: couldn't open version file, error=%ld Error: couldn't read from version file, error=%ld Error: didn't read all of version file Loaded version file kernel Error: couldn't load ELF file '%s' Warning: checksumming bypassed. Kernel is unvalidated md5sumversion file didn't have an 'md5sum' entry version file's md5sum was invalid Kernel checksum didn't match that of the version file: Image was corrupt. Please upgrade your image. Image checksum validated Warning: no checksum found in version file - kernel is unvalidated boot_version_addr=0x%lxramtop=0x%xdebug=runtimedebug_verbose=%dtty0_baud=%dpromversion=%sExtMemAddr=0x%lxExtMemSize=%d MBclient args: %s Um, something went wrong and the file wasn't run ttttttttttttttttError: couldn't determine size of kernel, error=%ld Error: couldn't open kernel, error=%ld Loading kernel error during read: bad ELF header for 'kernel'.. not an ELF file? Wrong architecture? non-executable ELF file (no program header) too many ELF program segments corrupt ELF file: program header lies beyond end of kernel (base 0x%x, size %d) ELF file corrupted: segment %d attempts to load beyond real memory problem: segment %d starts at %d, before segment %d at %d error during read: short read: got %ld, expected %d  %3d%%%4dk 100%% - %s: %d bytes%s (dir) %s: %d bytes ========= short read tftp://bootaddrmissing host address and $bootaddr not set remote pathname too long :opening tarfile from %s couldn't open %s for reading couldn't read a full tar block tftp file had .gz magic but insane flags. 1.0.4error, couldn't init compression wow, .tar.gz file was < 512 bytes total. tftp: zlib error: %d nuisance, inflate() wants multiple passes kernelustar ustar00tar: bad magic '%c%c%c%c%c%c%c%c'. Not a tar file? tar: bad checksum %s not a normal file or directory, skipping tftp tar: seeked too far tftp tar: error seeking to next file couldn't malloc additional buffer to push chars back couldn't malloc buffer to push chars back problem, zlib needs feeding but tftp is empty Usage: tar list|cat tftp:[//1.2.3.4]/foo.tar lists members of tarfile retrieved by tftp listcat'%s' must be one of 'list' or 'cat' tarfile contains invalid filename '%s': must be relative path / creating directory %s/ creating directory unable to create %s touching ramdisk file unable to touch %s creating ramdisk file Error while reading: count=%d, errno = %d short read writing to VFS file %3d%% 100%% copied %s into VFS invalid directory prefix '%s': must be an absolute path untarring tftp file.. kernel tarfile takes 6 minutes, be patient /pc-flash.vfs_get_statstotalflashblocks is %d vfs_mount: new_vfs_handle_ptr: %lx vfs_mount: vfs_init_handle returned %d just before initing parent_entrynum just after initing parent_entrynum vfs_mount: vfs_fs_init returned %d vfs_mount: vfs_cache_mark_dirty returned %d vfs_mount: prev_vfs_handle_ptr set to %d inside vfs_initialize_handle: vfs_type: %ld, total_blocks %ld vfs_verify_file_system: Error in freeing block pc-flashbefore is sector valid in erase sector expecting here: after is sector valid in erase sector expecting here: sector %d is valid before erase_sector_at in erase_sector no error sector:block %d:%d - bit flipped in byte: %x, bit: %x value: %x sector:block %d:%d corrected value is %x sector:block %x:%x - 2 bit error, cannot be corrected, %x:%x sector:block %d:%d - 2 bit error, cannot be corrected, %x:%x write_header: before write_header: after value of nandornor %d %d inside clean trash after is sector valid before erase sector %d after erase sectorend of clean trash allocating flash_handler and self is %x error in init_flash_if error in allocing self->write_cache just before if block total sectors are %d and totalflashblocks_per_sector is %d %d sectors were missing magic. init flag NOT set, aborting setup erasing all sectors erasing sector %d/%d Verifying Flash card - can take up to 1.5 minutes/8Mb total_flashblocks is %d counting blocks in sector %d/%d block %d flags is %x before nrdb b Add %lx &&empty is %d empty not emptyinside flags_inuse, before inside flags_inuse, after before trash block after trash block duplicate block for vfs %ld: %d:%d(%d) vs %d:%d(%d) new %d:%d wins old %d:%d wins mangled block at %d:%d (flags 0x%02x) just after parsing sectors&blocks just after clean trash found reserved sector %d no reserved sector no free sectors at all after the loop for least-used sectorcompaction isn't going to help: least_used %d, most_empty %d getting out of flash-handler newLegend: E->Empty, W: Writing T->Trash, I->In use !! ->bad Sector: %d XWITE E:%d W: %d I: %d T: %d !!: %d !totalflash blocks is %d (ހMȀv4~@\gU(ހ$(ހ'(ހ'(ހ(ހ'(ހ'(ހ(ހ&;(ހ'(ހ'(ހ(ހ'(ހ'(ހ/vfs error in %s: Bad argument Component length exceeded %d Component is null Bad free block signature Bad VFS block signature Bad directory block signature Bad file block signature Bad directory entry signature Bad file entry signature Bad extra entry signature Bad free entry signature Bad cache buffer signature Bad signature Current entry is not a directory Current entry is not a file Directory is not empty File is still open Bad count for number of directory entries Bad block number Bad entry number (entry not found) File system is full Free entry is not available Free block is not available Bad entry number No free cache buffers Bad cache buffer Error creating VFS on disk Error opening VFS from disk Error reading VFS from disk Error writing VFS to disk Out of memory Given path is not an absolute path Bad path Directory already exists File already exists Attempt to read beyond end of file Bad file size Bad offset NULL Pointer Error closing file Bad VFS handle VFS handle not found Bad mount point Error opening file as mode conflicts Bad mode for open Bad open file list Bad open file signature Bad open file node Error getting lock Error releasing lock Error flushing file No more entries in directory Cache buffer is in use Bad cache buffer in use count Bad file open count You're really bummin'. Your flash is hosed Unknown error %ld a$a8aHa\apaaaaaԀaabb$b8bLb`btbbbbbĀb؀bccc(c %08lx: bit %d ok BIT %d BAD Error: the pci bus test failed. Run 'pcibustest' for details abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 ledsuartnia_memext_flashint_flashethernetcpu_memcache_funccache_sizepci_busmemory aliasing test : memory mismatch @ %08lx : expected %08lx ; got %08lx walking 1's test : memory mismatch @ %08lx : expected %08lx ; got %08lx walking 0's test : memory mismatch @ %08lx : expected %08lx ; got %08lx I-Cache %d KB, linesize %d. D-Cache %d KB, linesize %d. L2-Cache %d KB, linesize %d, L2-Cache %d MB, linesize %d, enableddisabledcache %s. L2-Cache not detected. I-Cache size mismatch : expected %d ; got %d I-Cache line size mismatch : expected %d ; got %d D-Cache size mismatch : expected %d ; got %d D-Cache line size mismatch : expected %d ; got %d S-Cache not enabled. S-Cache size mismatch : expected %d ; got %d S-Cache line size mismatch : expected %d ; got %d T-Cache not enabled. T-Cache size mismatch : expected %d ; got %d T-Cache line size mismatch : expected %d ; got %d %08x -> %08lx: pci bus bit %d : OK pci bus bit %d : BAD PCI Bus : Walking 1's Test : FAILED @Couldn't allocate tx packet memory Couldn't allocate rx packet memory xmit pkt size 0x%x -Packet sent: %02x rcv pkt size 0x%x -Packet received: check dec : packet length mismatch check dec : packet length : OK check dec : packet data mismatch check dec : packet data : OK check dec : timed out waiting for packet Did you attach a loopback connector to en0? NIA Queue Memory (SRAM) : FAILED NIA Network Memory (DRAM) : FAILED cpu_core : start = %08lx cpu_core : end = %08lx cpu_core : size = %08lx Problem in cpu memory sizing? Uncached memory test failed -- Check DIMMS Cached memory test failed -- Most likely a problem with primary/secondary cache Cached memory test failed cached *0x%08lx: 0x%08lx uncached *0x%08lx: 0x%08lx Couldn't allocate memory for cache test Initializling Cache Writing to Cache Setting cached addr 0x%08lx => 0x%08lx Unexpected cache flush @ addr 0x%08lx Flush back first line Cache flush failed @ addr 0x%08lx Flush back second line Writing Direct to Memory Setting memory addr 0x%08lx => 0x%08lx 1 Unexpected cache invalidate @ addr 0x%08lx 2 Unexpected cache invalidate @ addr 0x%08lx Invalidate the First Line Cache invalidate failed @ addr 0x%08lx 3 Unexpected cache invalidate @ addr 0x%08lx Invalidate the Second Line check flash/int-flash/prom_diag/int-flash/pc-flash/prom_diag/pc-flashExternal Flash Not Present, Mounted Incorrectly or Corrupted External Flash Detected Unknown Flash Mode file %s, already exists creating file %s prom_diagCouldn't open for writing : %s Couldn't allocate wr buffer memory Couldn't write file Couldn't open for reading : %s Couldn't allocate rd buffer memory Couldn't read file check flash : data length mismatch check flash : data mismatch check flash : data OK * Please verify display on UART2... UART2 TEST STRING: * Please verify display on UART1... UART1 TEST STRING: * Please verify that LEDS toggled %s debugshow Current Test Selection : clearreset%% Illegal Count Specified diag cpu_mod [debug] [+] [-] [#] [n] show : Show current test selection clear : Clear all current tests reset : Reset to default selection + : Add test - : Subtract test # : Test individually; ignore global test selection Tests Available : >>>>> CPU Module Test (0x%x times) <<<<<< >>>>> CPU Module Test <<<<<< >>> Iteration 0x%x PCI Bus Check : OK PCI Bus Check : FAILED Cache Size Check : OK Cache Size Check : FAILED Verify HW and SW versions for Cache Sizing Cache Functionality : OK Cache Functionality : FAILED CPU Core Mem Check : OK Cpu Core Mem Check : FAILED DEC Ethernet : OK DEC Ethernet : FAILED Internal Flash Check : OK Internal Flash Check : FAILED External Flash Check : OK External Flash Check : FAILED NIA Mem Check : NIA Mem Check : FAILED The following tests failed cScbootpc: socket failedbootpc: setsockopt failedbootpc: bind failedBOOTPclient broadcast....Size = %ld*bootpc: sendtobootpc: selectbootpc: recvfromplen = %ld plen - sizeof(struct bootp) = %ld WARNING bp_xid mismatch got 0x%lx sent 0x%lxNo response from BOOTP serverBOOTPD///ERROR - bootp filename exceeds the allocated file size In BootpFatal(), errno was %dbootpc failed to locate a network address Unable to locate an IP address for this host. ***Please report this problem** [Unable to continue] netaddrbp_file len is %dbootp source is %sRFC1497 Cookie mismatch at offset %dfound valid RFC1497 cookie, parsing...cookie position %d is %dTAG %d at %d. len %d, overrun %dWARNING len of tag 1 is %d not 4netmaskgatewayTIMESRVSLOGSRVSQODSRVSLPRSRVSIMPRESSSRVSRLPSRVSHOSTNAMESWAPSRVRROOT_PATHEXTEN_FILEYPDOMAINYPSRVRNTPSRVSend of cookie parsing, END tag foundReserved TAG %d at %d (len %d)Unknown TAG %d at %d (len %d)T%3.3dGuessing netmask from IP address rangeIP number not Class A,B or C. Setting NETMASK to zerobroadcastBOOTPclient Creating Request ... Bootp Transmit Packet Contents Bootp Received Packet Contents Bootp Opcode packet error Opcode = %d hw type = %d hw len = %d xmit id = %x secs elapsed = %d bp flags = %x client Mac clientMac[%d] = %x Client IP = %lx (optional) Server IP = %lx Server host = %s (optional) Your IP = %lx Gateway IP = %lx Gateway hops = %x bootfile = %s magic cookie = %d %d %d %d Extension code = %d (len = %d) %d %s found len=%dERROR %s length (%d) not 4 div%s_%dbootpc: gethostbyaddrDONEIN2HOST1HOSTFULLHOSTDOMAINHOSTSEARCHHOSTLEAF./:-_=+[]~()%&*^#@! Illegal char 0x%2.2X%s='%s' * attempt to load into PROM space attempt to overwrite monitor code attempt to overwrite monitor data attempt to overwrite monitor bss attempt to overwrite monitor heap attempt to load outside of memory + 0x%x/%d read failed (corrupt object file?) segment read not enough memory for 0x%x table cannot read %s table sym header bad sym header%d syms string symbol table corrupt string pointer only room for %d symbolsLoading ecoff file: %s seek failed (corrupt object file?) not enough memory to read section headers section headerssymbolnon-executable ELF file (no program header) too many ELF program segments Loading elf file: %s program header$7H707(77666ȿ6666xinternet host name, and file namehost:pathload symbols-sonly load symbols-ydon't clear old symbols-ndon't clear exception handlers-edon't clear breakpoints-bbesnybootaddrmissing host address and $bootaddr not set bootfilemissing file name and $bootfile not set remote pathname too long :%s: invalid executable object file %s: boot failed Entry address is %08x ¸ЀȀboot-\|/  tftpudptftphosttftp: missing/bad host name: %s tftp: bad internet address: %s octetfile closedsendto(eof)tftp: sendtotftp: selecttftp: timeout, retry %d tftp: recvfromtftp: %s tftp: discarded %d packets netaddr Note: network not usable until $netaddr is set 0.0.0.0ifconfig: socketnetmaskbroadcastioctl (SIOCDIFADDR)ioctl (SIOCAIFADDR)gatewayroute add gatewaygateway %s: unknown host lo0netaddr lo127.0.0.1netmask lo0xff000000ioctl (SIOCAIFADDR) loopbackroute del loopbackroute add loopback%s: bad value for $%s Rc:dfg:h:i:l:np:qrs:vping: bad number of packets to transmit. ping: %s ping: bad groupsize value. ping: bad timing interval. ping: bad preload value. ping: packet size too large. ping: illegal packet size. ping: unknown host %s ping: -f and -i/-g incompatible options. icmpping: unknown protocol icmp. ping: socketping: record routePING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfromިxxxxxxxxxxxxxxxxLxhxxx8xpxxތĀxx\ping: sendtoping: wrote %s %d chars, ret=%d ping: packet too short (%d bytes) from %s %d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (same route) RR: NOP unknown option %x--- %s ping statistics --- %ld packets transmitted, %ld packets received, +%ld duplicates, -- somebody's printing up packets!%d%% packet lossround-trip min/avg/max = %ld.%03ld/%u.%03ld/%ld.%03ld ms Echo Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set Source Route Failed Dest Unreachable, Bad Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Bad Code: %d(New addr: 0x%08lx) Echo Request Time to live exceeded Frag reassembly time exceeded Time exceeded, Bad Code: %d Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply Bad ICMP type: %d Ā؀0DXl dumping %d kb starting at page offset %d from base 0x%08x unknown host %s netdump: socket failednetdump: connect failed %d done %d.%d.%d.%d%u.%u.%u.%u.in-addr.arpaicmptcpudpH`H`HXHP HXHP HH HH H@H8H0%H0%H(CH DHEHoHoHHGGGGbfstalkcmdshellloginexecsunrpctftpbootpcbootpstimetelnetftpdaytimesinkdiscardechotcpudpLOCALDOMAINNAMESERVER X`PH``%.*s.%.*sJJJxJ`J@No address associated with nameUnknown server errorHost name lookup failureUnknown hostError 0%s: %s Unknown errorRRRhRXR@R(RQQQȿQQQxQ`QPQ8Q(QQPؿPȿPPPPhPHP8P(PPOOؿOȿOOO`O@O ONNȿNNNxNXN@N MMؿMMMMhM@M MLLȿLLxL`LHL LKKNo route to hostHost is downFile name too longToo many levels of symbolic linksConnection refusedConnection timed outToo many references: can't spliceCan't send after socket shutdownSocket is not connectedSocket is already connectedNo buffer space availableConnection reset by peerSoftware caused connection abortNetwork dropped connection on resetNetwork is unreachableNetwork is downCan't assign requested addressAddress already in useAddress family not supported by protocol familyProtocol family not supportedOperation not supportedSocket type not supportedProtocol not supportedProtocol not availableProtocol wrong type for socketMessage too longDestination address requiredSocket operation on non-socketOperation already in progressOperation now in progressResource temporarily unavailableResult too largeNumerical argument out of domainBroken pipeToo many linksRead-only file systemIllegal seekNo space left on deviceFile too largeText file busyInappropriate ioctl for deviceToo many open filesToo many open files in systemInvalid argumentIs a directoryNot a directoryOperation not supported by deviceCross-device linkFile existsDevice busyBlock device requiredBad addressPermission deniedCannot allocate memoryResource deadlock avoidedNo child processesBad file descriptorExec format errorArgument list too longDevice not configuredInput/output errorInterrupted system callNo such processNo such file or directoryOperation not permittedUndefined error: 0Unknown error%s: %s ((Ā(Ԁ(()) decwarningwarnpanicnoticenoneinfoerrorerremergdebugcritalertlocal7local6local5local4local3local2local1local0uucpusersyslogsecuritynewsmarkmaillprkerndaemoncronauthprivauthloglevelbad $loglevel variable dec0procspawnzombie exit Prom aborted - restarting. . . process %d (%s) dying from signal %d nonamepmonprocreset: couldn't kill all processesnested syscallnetaddrhostnamepmonnot enough memory for networkkmem_malloc: request for %d bytes fails kmem_suballockmem_freeUUUUؿUȿUUUDEBUGINFO NOTICE WARNING ERROR CRIT ALERT EMERG%s: PANIC: %s %s table is full YPYHY@Y8Y0Y YYYYXXXXXпXXXXXXXXXxXpX`XPX@X8X0X(XXWWWWпWWWWWWWWxWhWXWHW8W(WWWtempunused 51unused 50unused 49unused 48unused 47unused 46clist dataunused 44buffersubprocproclockffile descfileVM pgdataVM pagerVM pvmapVM pmapVM objhashVM objectVM mapentVM mapshmmapmemUFS mountUFS quotanamecachevnodesNFS mountNFS reqfhandlemountiovsessionpgrpcredsuperblkioctlopsgprofnameisonamesooptsifaddrzombiefragtblhosttblroutetblpcbsocketdevbufmbuffreemalloc - bogus typemalloc: allocation too largefree: multiple frees, type=%s free: multiple frees 0 pausepsignal sigtsleepsetruntimeout table overflowdup2: fdallocdx􌘀􌬀tfstatfilefdcopyclosef: count < 0selectHxp<acceptsofree dqsoclose: NOFDREFsoaccept: !NOFDREFnetionetconnetclssbappendaddrsbappendcontrolsemi-panic: sbcompress sbflushsbflush 2sbdrop  mbinitmb_map full m_copymm_copydatap20123456789%s%d: can't handle af%d 0123456789abcdeflolooutput no HDRlo%d: can't handle af%d Mask for route not entered rn_delete: inconsistent annotation rn_delete: couldn't find our annotation rn_delete: couldn't find us %s %x at %x rn_delete: Orphaned Mask raw_usrreq--.-.-..-x.,...-x-..Ā-rtfreertfree 2rtrequest deleteroute_output@@@@FFF@+=P-4;l;Lroutearpresolve: no free entryarp: ether address is broadcast for IP address %s! duplicate IP address %s!! sent from ethernet address: %s in_controlCouldn't unlink inifaddr from ifp Didn't unlink inifadr from list cksum: out of data ((H((D(XP(wxP(XPinterneticmp_erroricmp len|||xxz||y||xЀxy|ỳ|z4|2ip_init(@AAA==(A*؀(L@LXdprip_attachrip_detach$udp_usrrequdp control data unexpectedly retained DDDЀLTvt100tvi920flow_controloffxȀ؀dxLl`Pttyxdevinit: ERROR rxq NULL /dev/tty =%c%c.0.2[%d;%dH[?25l[?25hdobxXulscefg%(null)dobxXueEfgGNaN-InfinityInfinity@$?zG{xx X@$@$@$?6C-@$@$@$@Qcreate: size %d not a power of two QputQgetEB)ؿ)2ȿ3332ȿ3332ȿ33332п33d(d ddd(d d0d(d dHad(d dHad(d dHapd(d dHdXd(d dHdhd(d dHdxhxhphhh`hXhPhHh@h8 h0 h( h h hh nпnnnn,./ Z<(!x<@% @% Ԁ4446677<pȀ`H@80( w0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z- deflate 1.0.4 Copyright 1995-1996 Jean-loup Gailly X \ \\ \ \ \      inflate 1.0.4 Copyright 1995-1996 Mark Adler  #+3;CScs !1Aa  0@` ??      }@  H 0 п  @@ @ jUXkdpt4F9K 8ߪÐ|\{=ѫӗn>$c_@SXSPSHS@S8S0S(S SSSST TPSHSSS0SSS8S S(SS@SSSSSxSpShS`^^`^`_` Mar 23 2001 09:00:55prom-2.0.1.1dXd vfprintf: out of memory?C0' = -<d0 =h$߿ '('XPH < @<d0 =[@< =vd$(<d( =C$ 0-< <(d$8' ={.@(-' ={$!@- ={X -<<d$@ =y - - ={ (-<d$H =v' <@ - <@ -<߿X߲P߱H߰@'`'<@@ 4<4-$c*@$c$@''<0( D <#ݰ =~>'$$`$c$b$$v$$ =o0BPR$PQ$$$BP$`< =vd% -< =vd%<^ -$ <60- -$ <6$ -$ =~>'$$`$c$b $$$ =o0BPQ$$$BP$`$< =vd%$$$t<"-$$ca$B$<"<"p<"<< l<" P '@@@ =o$ ' =w$   < -߿߶xߵpߴh߳`߲X߱P߰H''H-$$xph`X ={P@-<-<d'<i<d' =v' <-<d' =v<-"<fRP@S@&U$$$}U+@"T@-C&1<&R&1#t${C<&Rb' &1"#P@ &1S&1"#@&"@&1S<$ =q(@ =q6$P@"&1<& <(' @- ={ -B!U+@<C&RT@&"@U+@<dB߿xߵpߴh߳`߲X߱P߰H''8-ph`XPH@@ ={y@7<fs' <*` -@- < <$@-$"$ - ={.@(-<" =p@ -(B @' - =p@(-<d( ={ -@ -<d( ={ -@ - ={. (-< <(` -<d( =v@(-< <N -@-z@($$'$"$;'$&P&&@D&@@<C&T&&$&@L-' `-e =l -@-Z@A&<B@7-<f ={ @&@&1Q#<C-B@$<C-BB*@ $<C-BR*@@ -<C-B@ ' @- Q#<(-<0-ƛ< =vd(( &< < =vd(8<*@&s߿p߶hߵ`ߴX߳P߲H߱@߰8'x<B'xx-H-P-`-h-pX@@ 8<f1- ={$@-*T@`-< - ={@-*T@`-< - ={@-c*T@`-&1"@& -$ < =~>0-+@M(D< ={d(h@$<B@g--$ -'(0- < V8-@_-&<P-B@&1< J-*@T-<&S44-`-<f ={E@&@&1Q#<"-"@  -$'(0- < V8-@2-< &e<d(p =v&*@&s< J-<B@-<f-<d((-<R-B `8- =v$2"<d(@<d$P =v&&R@&12"@-< =vd$P-߿߾x߷p߶hߵ`ߴX߳P߲H߱@߰8''H-P-X-@<f1D# -<d(8<8-<P-B<p-c 0-`$, =y⯣4 -@(- <0%`0-@< $<p-c`-b@-`- -<d(0-$<d# =y⯢, -@(- <0%`0-@&@ --߿`ߴX߳P߲H߱@߰8'h$$ CPg-P`$Bf< $`-' < =vd(߿ $'('$0( (P@$< < <B@Q< @<1`< `< -<1< -2"@*T@& =oQ -&*@C߿0߱(߰ '8$$ < <B<dc`< <B<dcC<#'$@D#D!<><N4cC(?B$C`<$c`''80(@< $<<*$<d(<B: =v$<c$'b2020<$<4c$@ -$<d)0<< [*BC!<d)P<- =v<d)<d)< =vd)p<  <4c$@ -$<d)<< |*BC!<d)<- =v<d)2"@<d)< =vd)p߿8߱0߰('@'0-$B% 0-kokokoko糢 '` -$0-'('xΗ$0B0cΗ4c0B =~> -$ =~>0-kokokoko糢跢ﳣ -$Η0-0B姢Η0c0B =~> -$ =~>' -$ =~>0- -$ =~>0-( - =x@(-(@ - ={.@` -( =P@(-` -$ =~>0-( -` - =x@(-($@(- =P@0-< - -$ =~>'` -$ =~>' -$ =~>' -߿`ߵXߴP߳H߲@߱8߰0'h'H-0-*bP@@8 <G' @*b< $*b@5$S*@c&$< ={d- @&RS*@#&10P@&R $  <(&@< ^&R% <G'$@F$$ ..($ <( &RS*@&1< -< =vd-(< $<f1 <d-8 =v - =p -$ b$ &PC&` $.b$^b$-b$= $B< j Tb'( $B< j <G(-@ +$ <( < j-߿P߳H߲@߱8߰0'X'(-(@0< =vd-(< $$$ <G' @H$ <G'$@C$ <$< -$ <G' @7$ <G'$@2$@`4B@`< $<C%G@`$C$@`< -- <G' @$ <G'$@$@`4B@`< $<C%G@`$C$@`-߿0߰('8'(-$0< =vd-(< $ <G' @ $ <G'$P@$$ | <G'p@$ <G't@{$3+@$' & < ={d- @&13+@j&P@&1C$@&R< &1 <G'x@[&1{B&R3+@&tpC+@< =vd.X<Y$<< =vd.ppt+@C$$' B#b#te+`t<fp' @(-$p+@ b+$+@$+@$< =oc -p$ <<$ -'| <0%0-@<< =vd.p< <0(-ptC+@pt<SC+< =vd-(<Y$' B#b#pd+`3<fp' @(-$p+@ b+$+@$+@< =oc -p$ <<$ -'| <0%0-@ << =vd.ptpC+@tpC+@-< =oc-߿ߴ߲߳߱߰''xh-`$S*xpXP@!($-$s'($U&RS*@%&<"< =vd.x<$ <G -@"$&1&RS*@&(@<$,04(@ 8@-<d.@(- =v0-<-<d-(<<d. =v$߿ߵxߴp߳h߲`߱X߰P''$ (P@$< -< =< =< =$߿ '('@- -$*@-($ -$ d$ i%K@$C!E<66<d/<H!B$cC!B@<$<d/ =v<$$*@$R$2@ - <(-2@$ <(--߿(߰ '0'-$ E <@(-߿ '('-$ E <@(-߿ '('-$ E <@(-߿ '('``-X-P-h-$x$Bp$h< @ -<d/ =o (-V PU$T$<<G@ -<c$bB*@$Q!E$b<" <G'@@$<cQ!E$c<# <G'DP@$<cr*@Q!P$b<"<< <(d+@-<BR*@$ - =v$@-$<d,@ =v(-<%$`$ - =~>' @< =vd/<%$@D<  - - =~>'  -$' "0B0c =~>"< <(d/<d/ <(@-@-<d/ ={ -@<<f/<d/ ={ -<f/@<f/D@?<f D,b @$ `-&-@C0Bb!&.@ -<d0&& @ =y-@ @ -<d0&R&&1&f! =y0+@@ -<d00'0 =y8- ={ -$BB! -(- =PW0#@DT!t#@`ůD<f  -<d0 =y0- ={ - -(- =P@0- ={ - -(-@0- =P =oQ --߿߾߷߶ߵxߴp߳h߲`߱X߰P''0-8 <G' @5$ <G'$@0$ <G'(@+$$ +@($b`!($ $$$b <(e($b`(<n-(! !<j$$ $$b$ <(e($b`(-߿8߰0'@'`-X-P-0<f1<B -phH@8 <*ޯ$@-C $ <( -<d1 =v@(-<1$B$V*@R-<f1&%$-b4@C$ (-"D!B$B,b@W!B@<$<$<$<$<-$$<b!D!E<d.x<$U!B$D!B@<&R`$b'$<' <G@&s<1$%<d10<&RV*@&1`< =vd1H<1$ -<f - =|$F@ $. =q?P@&@<d1`<d =v<1-$ =~>0-$($V'( (-D <#'(@-<d1h(- =v<1$<f1*r - <<0-0-@ $ - <0%(-@ --߿p߷h߶`ߵXߴP߳H߲@߱8߰0'x'X-h-H- -'0'@xp`P@b$ce*@$` -<d1 =y0--$$'0T` - ={$ 6*"@$" ` -<$"4` -<<d1 =y' <` -<d1 =y' <` -<d1 =y' <` -<d1 =y' ` - =z' Q!*B@!<d2 =z` -'0'@0 =q? -@$.(- ={` -&12*@&߿x߶pߵhߴ`߳X߲P߱H߰@''H-- <G'p@$ <G't@$tpC+@$$3+@$' & < ={d- @&13+@V&P@&1C$@&R<&1 <G'x@G&1{B&R3+@&' B#$b,B@$b;p0B@7t0B@3$ b(b@$b<$b << (!!b(!<(!!C(!"C(!#C(!ptD+@&-pt$B@ -d+`p<@-< =vd-(<@$ptE+@' $+P@' pt$B@(-e+`p - <(--߿߲߳߱߰''(-0 <Y' @$<U-ߣ <?߿0߰('8'- #$(b-$( =z - - ={@-"!$B ={X - ={ -Q!@"S<d2 =| -@-'  (- =|0#' <Y' @2' <Y&@.$+bߢߣ<C-ߢߣ<C/<d2 =| -@-''  (- =|0#' <Y' @' <Y&@$*bߣߢb8<Gߣ`< =vd2 <-ߢC` B<$#$^b$@'&1 <Y (-@-<<xd20ߢ<?B<~Bb @ -&1 <" (-@--<d1h<x<d, ={ -@$&<d2P <"@ -<~@-$ '&1 <&) (-@-<| =q6@?< <*d2p@-$b(bP@$`@ -<"b$b@ -<"@ - (-<$  (-<$@ - (-<$ (-0- =m<)@-< <(d2p<d2x<mU-@ - (- =m0-@-N-< <(d2p<d2 (- =v@0-<-$ =qN@1'<f2 <* -@-`$@ - (- =m$@-1-' <&) (-@-(<<x b' <&) (-@-!-@ - (- =m$@-<<x <( -<d2 =v@(-<- <&) (-@-<d2X =v (-<-B-߿ ߲߳߱߰'(8-0-$$T@,$T@,$( @-'8-@-X-$ph`PH0(B $$$$<$< =vd2<$$2*@$$< =d2@<$< =d2@<$< =d2@$<կ$< =d2@&12*@&`Y<d3 =v-<<f<d3H =v`(--`-@^#D@@2W!E< =vd.p$ $ < (-@2@<@<< d3P<d3X =v<"$<d3P@<d3` =v@b(!&B,B@<d3h =v&<)&<d3x =v&&*@@<d/ =v&s*b@Y<d3 =v-<<f <d3H =v`(--`-@W#E@@2V!E< =vd.p2 < (-@2@<_@<<dd3P<d3X =v<"$<d3P@<d3` =v@C(!$B$B<d3h =v&<&<d3x =v&&*@@<d/ =v&s*b@$U-<d3 =v-<<f0<d3H =v`(--`-@W#G@@2V!E< =vd.p2 < (-@2@<@<<d3P<d3X =v<"$<d3P@<d3` =v@@b(!<d3h =v&<&<d3x =v&&*@@<d/ =v&s*b@-߿p߾h߷`߶XߵPߴH߳@߲8߱0߰('x<B<c'h-X-`-8-P-H-@$xp0<?$W*@I $t&$-b*@;$(-D!C$cg (bd@$bg$<+~$<+<2$<2&1D!E<d:<LU!B$D!B@<Q&R $"'$<I' <G@ &1<$<d: =v<$&RW*@&< <*d:@ <dB3<"T<dB6<e<dB5x<"T<"L -$ =~>0-<?$ <h -<-4c <#b+`0@*"< =vd;<$@ $$b < -@$$$(`<< =vd;(<f'(*1`< <* < <͏ @$ <0(- $B< < =oc < -0-  $ - <0%@(-T@ -`<< =vd;(<߿x߾p߷h߶`ߵXߴP߳H߲@߱8߰0'<BT'hp-xh<&H@-<dB3<"T -(- <&Y$ @ -<d;0 =y0-<H<d;8 =y'  - =z' <H <>@- ={D@-E<  - -<d;@ =z-(B@&C ,b&@<"-";@<BH0B|<(-8 =z - -<f;H =z(-<BHC0B|<(-8 =z - - =z(-<BH0B<(-8<j<BH0B|<(-8 =z -<d;H =z -<BHC0B|<(-8<j<BHC0B|<(-8 =z -<d;H =z -<BH0B<(-8<j<BH<cT0BC!E =z - -<f;H =z(-<BH<cT<0B|<BH<cT0BC!E =z - -<f;H =z(-<<BH<cT0BC!E =z -<d;H =z - <( -<&<BH<cT0B<<BH<cT0B|C!E =z -<d;H =z - < -<&<BH<cT0BC!E =z -<d;H =z -<BH<cT<gC<BH<cTC<Y0B|<BH<cT0BC!E =z -<d;H =z -<BH<cL<gC<BH<cT0BC!E =z -<d;H =z -<BHC0B|<(-8<j<BH<cT0BC!E =z -<d;H =z -<BHC0B|<(-5x<j<BH<cT0BC!E =z -<d;H =z -<BHC0B|<(-5x<j<BH<cT0BC!E =z -<d;H =z -<BHC0B|<(-5x<j<BH<cT0BC!E =z -<d;H =z -<BHC0B|<(-5x<j<BH<cTC0B|C!E =z - -<f;H =z(-<BH<cT0BC!E =z - -<`(-<BH<cTC0B|C!E =z -<d;H =z -<BH<cT0B|C!E =z -<d;H =z -<BH<cT0B<h<BH<cTC0B|C!E =z -<d;H =z -<BH<cT0B<h<BH<cTC0B|C!E =z - -<f;H =z(-<BH<cT0BC!E =z - - =z(-' <H<d;P1 =y0 - =z'  -<H<d;X1 <C0<&<BH<cT0B|C!E =z - -<f;H =z(-C $b<BH<cT0BC!E =z - - =z(-<BH0R0B@<B%' $B!(- <&Y0-@ -' <d;` =y0- - =z'  -<d;h <C0-<&' <H<d;x<.0<4B' <H<d;P0$ =y - =z' <&<4c' <BH0-C$<$B% <&Y@(-T@ -' <d;` =y@0- - =z' <d;h< -<BH0D$ <cTC!E =z - -<d;H =z<BH<cT0B|C!E =z -<&<cH0b@0r<B%<cL0B|C!E =z -<d;H =z -<' <cH0b@0r<B%0B|<(-8<{<cH0b@0r<B%0B|<(-5x<{<BH<cT0BC!E =z - -<d;H =z<BH0R0B@<B%' <d;x =y@0- - =z' <d; =z -<BH<cT0B|C!E =z -<d; =z - -<d; <C@0-<&' <H<d; =y0 -<' ' <d;0<H- =y- - =z' <d; =z -r&s =q?@ -@ -<@(-$. ={&*@&߿ߴ߲߳x߱p߰h''H-' @<1H<d;PP820 =y0-@ - =z' . @ 2"@<%@ -<d;X <C0-߿P߲H߱@߰8'X'@-' 8<J<d;PH =y0- - =z' . @ -<d;X <C0-߿H߱@߰8'P'@-P-H-.B X@8 ={$<b#' <d;@ =z -&' `(- =y@0- - =z' ߿X߳P߲H߱@߰8'`'0-(-8<fR(@#H << -@ @ -F <@(-@ -' <0%30$@&߿H߳@߲8߱0߰('P$<"'`-h- -$ ' xpXPH =~>@<B< h<"X@- < -<h <<f` =o@-$$ ={ -<h - <E(#<h <<cX<B\b!$bB$<"X<%$# ={ -<h - <E(#<h <<cX<Bb$c(b#b$<#X<BX -V!E ={.- < -<$ - <$<$ <$<$<h << <h ={ ! - <@(-<$<sh<$ <Rh! ={X -<h < !< <d' ߿x߶pߵhߴ`߳X߲P߱H߰@''P-$XH@ <@ <@ -@- J' =p (- ={X' ={y' @B ={' $P ={X -&<d0-<B $P$$<B<c\$c`$R-<$ -<f1 -<d<<8-` =y@0-0-*b@'$ <0% -@ &B$@-<B\$B@&R-߿H߳@߲8߱0߰('P' -(<Bh@ <d< =v&<Bh$B<"h߿(߰ '0'(- -8 ={0@-<chr*@ #!D =w&<Bh$B<"h߿8߲0߱(߰ '@' -(<Bh@ =w$<Bh&$B<"h߿(߰ '0<c$b8*@-d*@-<Bd #X$BB$$\$B<"-"`<B'08( $P-$<B\<#$B"<'-<dc`C!$- =z@(-@&b$<B\`-$BB$-߿8߲0߱(߰ '@'0-8 ={y(@T<B$BB$<(-` ={ -@E<B$C(b@<B\b<h<B\@< -`<f` =q<B\p!$B`(C#C$<"\ ={ - =qZ$D<c<#-"`@@ -< =vd<< ={. (-<B<$B(C#C$$<"<$߿8߱0߰('@'0( @$ - =wQ&< h<<Bh$B<"h@߿0߱(߰ '8@'$'$"$!Pg$f $P@ $C$<TE$<-@-'' <>B $C,b@<"-"UX@<$-߿ '(' <>D ,`-,8B߿ '(' <>B 8B߿ ,B'('(-0 0 <> -B $C,b@ <"-"U@2@2< %$B<%"!<4B $&"<C$<%C%$0<"-"ܰ<<%?-߿0߱(߰ '8$Pb `0?$b $<<-8B <<,B0B8B,B<cP<d<`<B`-$C -$$$C$-<"P<$'(-80 2' <(-$ <(-"P- - <@(-$߿8߲0߱(߰ '@'@-- -$ 0- =~>x< <*dW<"T*"@$fEb$Fb<B< C$@ - <#/@(-<<dW<S<<B< $ @X-< - ={<p-c`@ -$D*T@$<& D*T@ &<P-B@$"*"@$" -<$"$" -< < $<-D< ={dV@-- < --X<c$B`X-< -0T@ &$ <$z$@'  (-'X <8-@&<P-B@&1<f ={ -@ -'X <0%0-<-D ={$*@$D ={$?@$-D =}L-<B@3-'('@< - <$zP@%&<(- ={.'(<5@<(- ={.'@ =}L - =}L` -E =|& -@' E =|&` -@'  (-'X <8-@$&<P-B@&1<f ={ -@ -'X <0%0-<E <Y'`@-<$D ={$*@$D ={$?@$- =}LD<B@c'('@<f1-< - <$zP@T&1<(- ={.'(<@<(- ={.'@ =}L - =}L` -E =|& -@E =|&` -P@8&1<p-c0b@0b <dW0 =v$<&1@ 0b<(-ߦ`<P-B@ $<$@$<cTbߥ`<b< =vdWH<p-cߢ`<bߢ`#<?<?b$&1"@&-E< =vdW<-<B@'--< - <$zP@&D<(- ={@D<(- ={@&<P-B@&1Q!<C-B@E<dW<%<-@--D ={@&@&sS!T!@E<dWx =v<$@< =vdW0<$$ B@hD h C! ={E@ h $cD!B@hh C!B@"E <dW =v<$E =m'h@$<dWȎF <m$hd8G*@ <dW$F $ =v<$Q!<P-B0B @ <(-<P-B@ -<?pS!T!EFh <"'p<(-ߦp<P-B@ $<-S!T!< -EF <"h-߿߷߶ߵߴ߲߳߱߰x''8---Q!< -0@@-<f ={ -cb!$c (cP` -(- <0%0-@$Q!f<8-猘<dX( =y'0< 0 @ <(-<C-B@ -<<?<C-BVQ!<"-"@$<f ={ -@ -(- <0%0-@$-<fRQ!<f$&@ -7(!f <"-"X@ @5- ={@-#*T@`-&@@-<"}<"}@-$D-8C-8C-8C-D-?'<"|D#$D-8C-8C-8C-D-?'D#<"|$Q$B$@-q*T@ -`-߿H߲@߱8߰0'P$dB'܃8b$g%'(-0 <"' @- C$߿0߰('8'0-(-8 =q6@' (- =m$ @A- ,b P@=-<dcܰ<"C! <" -@-$b <B@* C!<(- ={ -@ C!<(- ={ -@ $Bb!<#-#`ᯢ C!<"-"T@"<"-"$߿8߱0߰('@'0- -(<f138% ={@ -P@&<# -* @&1$߿8߲0߱(߰ '@  <D-B<$@-<4B$+`-<$@-<4B$C%+`-'H-P$`'(hX<fRݰpB<C$@'0$<B8$$$*TbR'<<&R0<f -<<dY R!CB8?<?(0 =y⯢$P! <#'(@<dY8 =y -<#r!`F!D&<dYP =y -! <#"'0@<dYX =y -<#ކ<dYh =y -<d< <0%'8@o-<Q!<,B @'8<dYp<܄ <#0-<dYx<܄ <#0-<#-$ =m$ @2<,b @.(#<dY e($&C0C!e-#d-8e-?C # Bd!)e#<C(#<%L-<- -#b&$ ={& @--߿0߱(߰ '8<B'8-@0@(<%- <$$@0-(- -<dR$r3r+@P -C+T@ -$(@$<%-< -!C!CF!Pr+@C+<%&$@ (-*@!B+P@ - F!P<%---߿@߲8߱0߰('H'(-@-H80 <$ (<(>e-#d-8e-?C # Bd!s#C#<-"b & ={&%@ T.$ <$$<%$ <$ - <$$ ={ -@- =qZ&D @-&<%- (- =v&F<dcC!<cDr*`P<2<c$$c<#߿Hߴ@߳8߲0߱(߰ 'P'(<f10&28 $P =q - &12*@ <0-2"B@@$< =vd[P<'$*@*$-&DPU& <& (-&*@&R<'-@$*@$-&DPU& <'! (-@&*@&R<'-< =vd[8<'$<d[h <'! (--߿PߵHߴ@߳8߲0߱(߰ 'X'<d[p<dL <% 0-<f&+@m`-P& <*' @e&+@-<* <(Ɏ@@(- <*' <*-<db<) <(@<db =v<*$< <(dc@*< =da@< =da@< =da@< =dap@ < =da`@< =daH@<dc< <(dc< =da@ < =da@< =daH@-< '  -$ ' <.0B< ={di8@  -$$ =~>'  -$ ' <.0B@$$aG$v$<.2TPG$$@$a<.&s =q6@- -$$ =~>' <B@--<fD ={@&@&1<C-B@ -<dj $<.&s< ={di@  -$$ =~>'  -$ ' <.4B< ={dih@ -$$ =~>'  -$ ' 4B =~> <.&s< ={di@ -$$ =~>0-<.&s< =|&dj@P@$ =v(-@-$&s< =vdjH$ $C~&s~*@K&@<djp =v-<B@$<f< =vdjq&< =vdj@&s<dj =v-<dj =v$'@<*61` -$ =~>0-@-r<?Q8?b#@C!@b< =vdj<dj =v(-<.` -< =vdj- -$'@ =~>0-$C -<dj =v(-$ -$ =~>' <B@-$-<C-B$c<C-B@&s<(-<dj =v$< =vdjT -' @<$<do <*ޯ<do <*ޯ '  - =o(-$ =w (-<doH =v (--'@< '@$$% =o8-<1 -$% =o0-@f ={ -<"$($ =w (-<B!+@D'@& =qB$T@&"$ I+&P+@&1+@4#<"$<  $@$/b$S<2$b-$'@' <3`8-<2@-' <2z`8-@-' b#bH&$B<2bH"H!$  $$  $ <2.$ $ =w (-$  $ =w (-<1$$<2D$"$$ =w (-$$ =w (- =or - - <(-<do =v(-$<fR'$%HP&RF<do =v&R&*@&1<2n$< =vdo-߿߾߷߶ߵߴ߲߳߱߰''(-0 $Sb@-$b,BP@ <3,B<2#.$4 $b0,(# <3X($@<2$,B@$0(- <2' @<2$<2$ B$$߿0߰('8'H-X-`-h-' &EpP@8<  =nP$@@ -<B P!<" ={@$B|$$C$2b-(b3@$1b!'$<3N$$3bm$'$&E =nP$@c$$<BP!<"'$Q(! =nP$@W&1"$<B!C!<"'$` -Q(! =nP$@H` -&%E(!$:$<BC!<" =nP!@:"$<BC!<"!!&"B!#!- C$BC#@ '$@(- =nP$@! -&&1$ <(&R<B$ D!#*<"`'$'(@(- =nP$@ 2 T@ <B('0Bb$<3N<3N$-߿p߶hߵ`ߴX߳P߲H߱@߰8'x'-$'(-$ =nP@$<3<3$(B@!&'(- =nP$@& -$,$B ={@- ' (-%# =|0-' 쏢(!P# <%@ $(B@&0'(- =nP$,B߿߲߱߰''<B-0-(B@8' $eb$;0# =nP0@@ <dpP!<" =v@(-<3$< =vdp0$߿8߰0'@'`-p-$P-h'(xXH@80 ' <4(-@$/ b'!$B,b@<"-"p`@''" <4$@$<B0C3 <#@C$< <3' ''" <4$@-@ͣ' <4$&+@&<3' ''" <4$@m'$& <4<3' '$ <4(-@I''" <4$@\3@<B@<BC#<" <Bb5?%)&*T@A$(@$<5!<5"-$T<BC!<"<c0Bb!<#<B1C!<"$'0-8-@-(<f -P$$XH<"<"p<"E ={.$e<dq =z -<  -<dq =o@(-@-u/t"(bf@$bb$<5$sb$tb$<5<5C$<d< ={.dq<5D -< <G' @Z$ <"<5D -< <G' @O$ <"<5D -<cq*@<fR!E$b<" =z -<dq =z -<cq*@<fߠ<d =l -<?<?<"<0< ` $<6< x !B&RR!B@!<6&1 <dx <G@0$<6&< =vds<7$&14*@ <܄< < <= ?@<7$ <<`$$<"l <; <"X =v-<8&-$-<C-BD* &* @$c * @(-<dt@E! <0-& =v 0B@< =vdt ={ - =qZ$D@ -<0-$ ={.(-<(-<dt =v-<8<0- =w$ &*@h&4-< =vdt-߿߾x߷p߶hߵ`ߴX߳P߲H߱@߰8'' -$ <0- =~>-$'`<f-Ȏ' -<du =y@0-'  <&Y0-@ - =z' 0B@<dt =z -<0-  -<dt =y'  - =z'  -' <0%0-@& &R*B @&s <f1X#0b@+$ <du486p$<? =v0-' (- <&Y0-@<du( =v' < =vdu0"0B@< =vdu8"0B<?@< =vdu@< =vduH߿ߵߴ߲߳߱߰''H-*bh`XP@8@R0 &b@P-$$ <fX- -< ={duP@' <9I&1<8&R =m$ @3 ( @@E!<C-BU<<8dux< -<#-5&1 =q<8&R ނ0B@<8<dux<8$ <du =v&1&R&bB*@ -<9-%< =vduX<9$ <82-߿h߶`ߵXߴP߳H߲@߱8߰0'p'<$@80( <BC$ b-< <-$$ -< - &1R<(- <*" @& << ߿@߳8߲0߱(߰ 'H'(-0$ -8< -<0-2&1 =q*" @& < X߿8߲0߱(߰ '@' <f( < <<0 ?@$ < ? <=(-@$$<"l <;<9<"l <; 0-<d =$<Bݘ<cݠ<?<?<Bݨ<c<?<?-2b@<<?4c<b#b+` -<dw<=`(-<dx =v-<>4<6&1 << -@ (-"TP&1&1"T@ 46+P@4&1"@6+4-$6+P@$0,b@@w<"-"x@2?$C,b&@m<"-"y@$24Tbd&1<4B$<h4Tb\&1u+P@Y&1<>{#0C,b@Q<"-"zX@<>$B0C$b$ TbD&1<>$<$<h<<>J`(-Tb9&1(-0D$$T@1&1%4<$<C$$ <=b&1<>$<$<TH&1<$<b <$$ <=o0#<@#<><dx8 =y0- ={ -!$(&$$,$ - <=D'(@$(&Lߦ(<dxP =y -<>ߦ(<dxX0<0? =y - ={ -!&1*"@ -<f1 -' D$) <0%T@?-T*<dx` ={. - ={ -Q! -(- <&Y$ @ -<dx8 =y0- ={ -! -<dxx< =y`0-  - ={ - !<dx =y0- -D <0%' @-- -< -<dxD <0%' $ $' < $ $"& =~>,< '@ =x$P@Q<d|< =P$< < <  ' @'$< =x$$߿0߰('8'0-t|' -!<f10| <" <9<"$<"l <d`B0!<d<d =v@(-< =vd` ' -$$' 0B4B =~>$߿@'H'@-P$ <dX <(H ' -$$' 0BR% =~>$Q@- <C4ރe<"< 0?<"!<$!<$! 4.84cEC8-P ?$$(<(>E-C-E-C-E-?#BC!b# #$$<Q5< 5)Q<0@43<>HP ?B@C!C!T(!<>HP ?@C!C!+(!+@0#$B<Q4cCP ?B@C!C!<><Q4cCP ?@C!C!<d4.84cECP (?,@E!b#C#0#<>484cC484cP ?"D#@D!0#<>C$ P ?BC#0#$,<@-,<@- ,@-,b @-- @G0B<"-"$ca$+@-$0B,B@C$<?E$D,b@<"-"@0?(b @(b@0B<"-"ܰ < ?<\0C,b@<"-"@0B<"-"ܰ@l<\0B<"-"ܰ@o<\<4B$<c4$8dcd$<?<\C !<dܰ0cd!B0BD!cBbG<\<dܰ0cd!B0BD!cBbE<\0B<"-"ܰ@0<\0B<"-"ܰ@3<\<$<C40C$b(bP@$` <\b$b <\<B<C$@ <\<B<C$@ <c<>b$<?$B<\b !<B<>C$<?$D-' <[@(-0<%:(@@ <$<c|<d#b+`<4BE+@$<c|<d!b+`<<4BE+@$<c|<d!b+`<<4<c:(<b#+@< b!+@ <4B<c:(<Hd!C+@ <B:(C<#:,$ <\C< :(< :,߿ '(<B<c'( 0B|<?(c`<d@ =v(-<dh<ܥ<>($(< =v(?<cݰ<b$P@.=<4Bb$<"ݰ<]F$@!<"-"x@<]F$<<dܤ<>$<?c4B Tb$d<]F$<]F$<]F$ <]F$ <]F$ $߿(߰ '0'X-$h`PH@ < 8<c$/b $<cb <[<><" <^ <\<f.p$S@-0B<"-"<".q2b<"-"< .s<".r <[ - <[<<-<f1"<<f"< .p <[  -$B,b5@%<"-"Ð@$SB0B<"-"B2b<"-"@<^B<dܰ<^0$@<d"<dܰ  -<d =y@0-@ - =z(-< <(d@ <f> -<d =y@0-@ - =z(-<d =z@ -<d <($@-$h$v< <  -<d =o`(-UT P$<B$B<"<_% -<R<_% -<cq*@<f:0S!E$b<" =z -<d =z -<cq*@<d<f1:0 =v (-<f>0 - =l (-<?<<"<B?<0< @@ -<d( =v@(-@ - =v(-@(-<%$<d8 =v@(-<_$<BP@$< =vdH$< =~>' $' <$ $"& =~>, < =vdȎ< =d@ <dh =vߨ#b+@!b+@!h#b+@~!b+@ <|$+@f!+@&'<d݀ =v (-$"P#(b@C!C<"<B(Bd@$$' <$@8-P-<CA4BCH<c $c<#<CA4CH<B$ T0- TD9$ @@b<ce<"$ B,b! BS$ <DID4cRE<FI4BLE$ "0B@<DI44#4BRETb<FIcU"@{$% $w$ (e  - T6b  8-@-$<{0$#s@ --(- 0- 8-@-$<{$$j@ --(-<FI4LE @8-@- $9<d = -@3R1$=<~$(@E$($ ۯ$B -EU* $\ X@(-&p$0- <8-@ $$$<$$? b  -<FRb$4cEHC@(- - <@(-<-@(- <&f$-߿H߳@߲8߱0߰('P'(-0-0(8-$4@ &@$> < --߿0߰('8' <߿ '('@-P-8&0 -XH"(@ - -#,(-` " # `"&$",@ @(-#C*T`"" &RB*@&$"h@"$Bb/#d-b-?Cb#<@#"B$BC""h@ - <5(-@-$ =qZ @" -<]<f1\(- - <@(-/ -"@  -@ -<d<(-'($"@ ',@ -< =vd(,< =vd؎"@  -<- <(-@@-<0]b!<4B!S*@<?Q<d`<$?Q<dh(?) =v(#`-L`,0<d` <@-0<< =vdx<,0<d` <(-@-0<!<d <. -< =vdȏD` <` V<>V?C#C!# ?C#C!"#X%߷8߶0ߵ(ߴ ߲߳߱߰'@<dBXX-`-h-<.--@N X'<eX%%%%%%%%b&0BN!C bX&d &0 ! bX&e(&0((! bX&f0&000! bX&g8&088! bX&h@&1@@! bX&iH&1) H.H!# bX&jP&1J PNP!C bX&-@% '<dX%%b&0BD!C bX& ''$4$<$@$ <=,߿@'H'P0-`@-X-8-H-h(@ C$1b$$8<$@$B @@<dBB @(B$@$<dBB$$R$a&$#,B @ $j$&b,B@. @/@$<$D(B @ $@- $<$p0&Q$D"D484c& $$B<>C% $@$253$&($H@?B"LD(B @ $",D(% B @ $"4D(%@B @ $&p(-"8%D(B @ $#,@0-` &"4@"8@@ -<B @ - <Ь<$"%#4x>|7B@!"@E!b! xE-xE-C-E-?#BC!)@(#$$q <`@$%0 < -%2 < -$"0@ < -"@ $<"@r*@$B$b "@ <c $<ɮ#"@ h@@?$b=$x -@C!<"-"@ @(-@-$b,B@$`$b$"T@7-<$Tb"$C - <"-"@@$B$B$bcC0c$b -$ b<dB`<9$Bb+`$ <dB<9$@$B$c$bg*(! < >xD-xD-C-D-?#BC!@b#-$ <dB<90 @$$<@$B-$B$bbb$b@$B-$B$bcBC!$b@$B-$B$bcBC!$b@~$B$B$bdBD!bC$0$@$ca$B-$-<#-$}B0&$B0*@$c*@*$ <#-$}B2&$B2*@$c*@* $<#-$}B.&$B.*@$c* @ $<#-$}B0&$B0* @$c<d}@$ <' -$- -<1-2 <ë$<1-"&*@&1$<" l߿p߲h߱`߰X'x' ( <-& <dB ( & | <dB @ & p $<dB X ,$ - <߿(߰ '0$$t`$BA$c$$t` |$BA$c$$H` p$BA$c$H-@@I!$DK P*`8 Eh!+`!*@"!J TG P e!E!dC+T@ % *!'!DLbLD+@%I!G PE!C+@T0-'!LBLC+@ 0-I!G P$D@@*@*I!K P'@-P-$%XPOM` 0$$cHH!B PN!@H$I)"=@1 H`! PXn8!N!B$F*@%*0-%J@@H!C 0$cC 0*@ -#P!D!bQ! x!BD!bQ!%))"=@%@9 @H(!%@H!b 0T@@$cb 0@$@h!b 0d 2$B$b 0d 2 0%J$B@ꤢ 00-@HP!E 0P$ H8!$ P#*@%)N !F#CQ!$T$$%J߱߰''P-8-$'"$`XH@$$!8@g(@$c@-' -P &1@S!D$ <ëC&1Q*@&߿`߳X߲P߱H߰@'h'(-X-H$0-`P@8EU $=DH`-bP@ `D -$BDP!T PL$&15*@$cD(bP@#$$bDP!*@$d P&-$' !EB|@ ` -@DEB@ ` -@>B&1U"*@&< Cb@-$'  !EB|@ &1BS"*@&C$b@-$' @EB@  !B&1S"*@&D $C!(,C!<D! -$' !EB@ ` -@AEB@ ` -@;B&1U"*@&<ǖCb@-$'  !EB@ &1BS"*@&C$b@-$' @EB@  !B&1S"*@&D $C!(,C!D!߿xߵpߴh߳`߲X߱P߰H''hh-H-(-P-xp`X +b@@ $--,!^&&R !!Ebx@ 0-@:&@^&$&1'+T@-d- $)--, !^&!Bb &R&@$$&1'+T@-<Ȝ-<Ȝ$ =qZ$@- -$ =v$ -(- =v$'(- <dB?<dBA\ <dBA<dBCx<dBC<B B*@E!F!'8- <64H@0(-0Bߢ <fs#<f1#$"0B@$<"<$5(2-$#& f*@-#$$*@*@Ā#P*T@@- #$ !`(- =n0-p!"$P#P!"$"$# C*@ " - <󸧢" -' <$@-$" "P!" @#߿`߶XߵPߴH߳@߲8߱0߰('h'@-H-`XP80( @$<d9 =@0-"$Bbr$߿߾߷߶ߵߴx߳p߲h߱`߰X''X`---h-x&$p'P$X(-0-$,$ = 8-T` -< = td9x<$ =$$ `(-0-8-)'0 AB@@!1)$ "b%'H HL =$@-$bP`&R<'0< = td9<$*B@$$<<"<$<d9 =@0-<(-(-$'8T$'T,$ =8-A< = td9<$"@:<":"b(-v@$<d9 =&0B<b-c8<#<$$b(-#C-$ <>@$<d9 =@0-"$Bb{(-$߿߾߷߶ߵߴx߳p߲h߱`߰X''0-(-8- &0@$ ={. - ={@ -!& - ={.`(- ={` -!&#߿@߳8߲0߱(߰ 'H'X-P-p$h'8`'Lx -<@4f =I'HH@  -&'0$8-L$ =,<d>< 0- =v8-<B&RB*@` -<BP$0BC- =w$.<d0 =o~-߿hߵ`ߴX߳P߲H߱@߰8'p'`-8-P-' (-phXH@ =f0-0B&b"*@-<BP0B@ =<d@<d>@ 0- =o@8-p (-G =v@0-< =vd><B@<?<b4cMC<d>@(?)(#1@0#00!0 =v0#< =vd><dc<B$"*@=&P$fP"&1<d> =v (-<B$"*@.&P! -&"C@"#T< =vd><d> =v&1<B"*@&<&&<B"*@$c<&<BP0B@ <1<d? (- =v@0- <4@ -&*b@$b(bP@$P`-Jh#,@C#C!8#4P 8?9B@G!G!"H# I!@$@E#E! =v0# = -߿H'P' -(,b@<"-"C0@< =vd@`<,@$<"-"C@< =vd@p<< =vd@<< =vd@<< =vd@<< =vd@<< =vdA<<dA(<< =vdAH<$b(bP@$` <b$b<< =vdAX<< =vdAp<< =vdA<< =vdA<< =vdAЎ<dA<< =vdB<`$b<< =vdB<< =vdB(<<dBH<<dBh =v +@s(- 0-,8- =ȯ$@-k0! = -&1 - =0R&1 - =0S0P$B&1<dB+@S0!& ={ -$P!=e#4$ VBF0!(- 0-,8- =ȯ$@-=0!<4<dB=t$VB40!D <BV-0!Lh&=e0!<0rL$<"=I< Џ4&<4 ={ -$B!&2b#!<dBB+@ -&(- =n0-@-D0!%D<%<DU$<"=t-<dBȮ߿߾߷߶ߵxߴp߳h߲`߱X߰P''0-8( =q6$@5$"@# -#$.b.$ <= -<d$C:<dB<dcQ<#̬`$<#$<#<dcd< <#= =q6T@&$.b&@$.b$$ -$$ ='(A'( =<c$=b - =$ -=$<"=-@(- =0-߿8߱0߰('@'8-H-@-$PB50'0&'" -$"<dF =y⯢, -$$ '0$ =N$A'0 =<c$=b- -`(- =)$=@(- =$@ -P-<dB謒 <"< #<#=--߿P߳H߲@߱8߰0'X$<"-$<"--'0-<dF8( = @$<dF =@ -@$<dF =@ -@-$<f - ={.@(-<dB<dcP<1`<#߿8߲0߱(߰ '@'0-<8-@( = =@- % =@ -@0@ =@ -@&@=h`$ =`(-@<B@ - = -߿@߳8߲0߱(߰ 'H< ($<"(<( @E!<dcFC !@=-<dƤ<dB < $<"C<" <dcHp@-<dcHh<#$<#($ X-@-$$`D`!$$.$\0b@X$$= +@:$%!L+@+%bCX!$c`)I.%J!$BL+@($% E+@%$ca=0b?F#$M0b?CC%P!D+@$E+@#%kb*@=$C`%JFh#-'p-`-H-X-8-@-hƸ!xP0 &-bP@`-&sbT@&s=;`--0A&1$.&$(-0-8- =(@ -ߨ ߩ( &E+@54bB$#^#= %"b+@@-r&s`@-=o&RVW+0 &1W+@P&R0&1$\0&1C#$D$BR&R,B?@ dW+T@@V=$&R^#߿x߾p߷h߶`ߵXߴP߳H߲@߱8߰0'+@-$b@ $c0F=b!$=$ce+@d#+@7$$$ .$ \P-h&%i1P@%N1?=$BPL"$PM%J#%)BC%J%H%J"@e# =$#C%H!(%)BT@$=e#$+@$b%C%C%C%"""'H-<d<dHx%0Bxph`XP@8@0$`hlhlhlhl$ $ =5$`$ $ <dI<fR$@<"$5<"$<" <(@-&D.(- =|$< <(dI@-3' -(- =|$' $ $ $$$5&CC!P@$*bP^ -PW -<dI =| -@-  &1 <= -BV<#- = -&R&s<#-5<#-4 -*b@<3<f1"@H-' =$@ H-' ={$.@- - ={.&H- '<fR&BB&R@-@ -$.PD&1&@<f*"T@@&S+@  - ={$.$PP&1*"@&R@<d-4c߿x߾p߷h߶`ߵXߴP߳H߲@߱8߰0''hX`ph---x-@EP." T@Z$@ - =$ <dc&P b&1$Bb2cBB0BC%B<c0B0c@C%B<c0B(,0cC%0BB`'P$b& =C#&1  -$(- 0- ='(@!2 =(-&2 =(-&$=BB"*P@@ =C$2 =&E 2 =&E - =&E2 =&E&P(- =n0-!$B#߿߷߶ߵxߴp߳h߲`߱X߰P'<B'H-X-`-P-0B@h =$C -=$ -(-@0-`8-'H$$,4< =կD@(- -$<"=- =e 0-@(-$<"=-#0bT@0c"@-0c,b@$<"-"J@=$=$=$$<"$߿h߳`߲X߱P߰H'p<B'p@-X-`-h-P-xH80B@0 =$Ca$@ -$< <"B@ -$.PC&1$@ $. =c@ -@ -(-$0- =N8-=<B0B@9=b*<B0B@%<f@ @ -$0-$, =)8-@&$=<BH$<BPS&$HS <B0B@&@@ - @ -(-0-8-$ =),@$<"$߿x߾p߷h߶`ߵXߴP߳H߲@߱8߰0''@-`-P-X-H'0h`8 ={$P0!C$.Tb -.@ -@(- =n0-P!=T@=T -@ -<dJ$ 8-$$ =y⯣,@ -`(-0- =N$߿hߵ`ߴX߳P߲H߱@߰8'p-'TT<B---$<\lt0B@ =$Cw$<#<B0B@d*@$ d<dcb1-@J~<B@@-'L'0<fRd <B<A-$$ =0-<"@@ -@(- =$@U'8$<T'H8$H<D =@&CE-$H<H =(-@0- HF#H0B@!<< =$ $6<)V&RtU &R$ t&R=&s\1*@-^$=HHH`<(- =0f@0- HF#@-H0b@! << =&R$ <)="\)#4BH0c`"H,b@$`0-< ='H@0-HF#H0B@=!<BA $$ =0-<"A<=&R<B$ I` 0-<@(- =$@}0-$<T =8-=o$<<d0 =-0-8-T<$$ = ,TUc&R<B0<Bb@ $A<a 00\@4$ 04 =$0-<B$DBi!0B$ hI@%h8- =$@0-1&R(-$ =үl<\ ="8-@-Z $&R"$ l~"<B0B @"0B@ $ < =ѯd$ <)=< =ь$ <)= -&R<B&sb*@<B&*@< =$<"d $l $<$=<"=$<"=$<0߿߾߷߶ߵߴ߲߳߱߰'<' $( =<0<dBC$d$C߿(߰ '0'0$ = ,߿0'8'0$ =,߿0'8'0- @<d@< =odJ<c<BJb+@<0-=CJ(<dJ<d@< =odJ߿ '('(-X-8-0-P-`H@ 0 - =qB -@&100$+$-:-,V&1`$#$0b$ &10$x$$X$=$b$0#b &1"8Bx,PV&1$X&10$S` ! =q6 -@ & =q( -@ =q< -@&&*@+T@$V &1S'D+P@D!$&10$"#$"<"$V@-߿`߷X߶PߵHߴ@߳8߲0߱(߰ 'h'(-`-8-0-P-hXH@ 0 - =qB -@&100$+$-:-,V&1`$#$0b$ &10$x$$X<= $b<#$0b <&1"8Bx,PV&1$X<&1<4B0S` $a<A #<6 =q6 -@ & =q( -@ =q< -@&&*@*T@$V &1S#D*P@D!$&10$"#$"<"<6R<W@-߿h߾`߷X߶PߵHߴ@߳8߲0߱(߰ 'p<B@+$B<"<B+@<= rdBR<"-"J'0- <d@< =odR< = `<d@<dR =o@0-߿ '('( -' '0@$ =,@$<@8$B88߿@'H'(-' 0 =f(-  ߿0߰('8' <6(  = p$RW$4B@ -$ = @0- = &1@ - = $ @ -$ = 4F = @ - = $ @ -$ = U0$ = !@ -'$&$$$$ 7 = p$RV$4B@ -$ = @0- = &1@ - = $ @ -$ = 4F = @ - = $ @ -$ = U0$ = !@ -,%@ -$$ = $ @ -$ = 4F =  = @ - = $ @ -$ 0B+"&1b% = @ -$ = P0$ = !@ -:@ - = $ @ -$ $ = F0$ = <@ - = $ @ -$ $ = F0$ = 61B@@ - = $ @ -$ = 4F =  = @ - = $ 0B@ &1 = @ - = $ 0B@ @ - = $ @ -$ $ = F0$ = = $ = $ @ -$ $ = F0$ = @ - = $ @ -$ $ = F0$ = @ - = $ @ -$ $ = F0$ = -߿x߾p߷h߶`ߵXߴP߳H߲@߱8߰0''0-8-@ = $ $C$4B$C$ -$ = 4F@ -$ 0-'(8- = $(߿@߱8߰0'H'8-H-$ @-P = 0$C$4B$C$ -$ = 4F@ -$0-8- = $@- -$$0- = 8-= -$`0-2R@8- = $@- -$0-8- = $- -$`0-8-'( = $($R&+#C$߿P߳H߲@߱8߰0'X'@-X-`-$ hPH80( =  <4cC$$$$$ -$ = 0- -$ = 0--<6<6R<< - = $  -$ = P0$ - = $ R$ -$ = U0% - = $ P$ -$ = S0%&1*"(@ - = $ <6 -$ = P0$ - = $ <6R -$ = R0$ - = $ P$ -$ < = Q0% - = $  -$ = P0$ - = $ R$ -$ < = S0% - = $ P$ -$ = Q0% - = $  -$ = P0$ - = $ R$ -$ = S0% - = $ P$ -$ = Q0% - = $  -$ = P0$ - = $  -$ = R0$ - = $ P$ -$ = Q0%$<6R<6s<< -$ > = 2 -$ = R0$ - = $ S0$0% - = $  - = $ R$ -$ = U0%&1! -$<6R<6s<<$ 7 = 2 -$ = R0$ - = $ S0$0% - = $  - = $ R$ -$ = U0%&1! - = $ <4cC$$$$$ -$ = 0- -$ < = 0% - = $ <6 -$ = P0$ - = $ P$ -$ < = Q0% - = $  -$ = P0$ - = $ P$ -$ = Q0%-$<<6R< - = $ U$+"% - = $  -$ = R0$ - = $ R$ -$ = S0%&1! -2߿h߾`߷X߶PߵHߴ@߳8߲0߱(߰ 'p'H-`-h-$ pXP@80( = &<4cC$$$$$ -$ = 0- -$ = 0--<6<6R<< - = $  -$ = P0$ - = $ R$ -$ = U0% - = $ P$ -$ = S0%&1*"(@ - = $ <6 -$ = P0$ - = $ <6R -$ = R0$ - = $ P$ -$ < = Q0% - = $  -$ = P0$ - = $ R$ -$ < = S0% - = $ P$ -$ = Q0% - = $  -$ = P0$ - = $  -$ = R0$ - = $ P$ -$ = Q0% - = $  -$ = P0$ - = $ R$ -$ = S0% - = $ P$ -$ = Q0%$<6R<6s<< -$ > = 2 -$ = R0$ - = $ S0$0% - = $  - = $ R$ -$ = U0%&1! -$<6R<6s<<$ 7 = 2 -$ = R0$ - = $ S0$0% - = $  - = $ R$ -$ = U0%&1! - = $ <6 -$ = P0$ - = $ <6RR$ -$ < = F0% - = $ P$ -$ < = Q0% - = $  -$ = P0$ - = $  -$ = R0$ - = $ P$ -$ = Q0%$&<6R<6s<< -$ 5 = 2 -$ = R0$ - = $ S0$0% - = $  - = $ R$ -$ = V0%&1! - = $ <6 -$ = P0$ - = $ <4cC$ -$ < = F0% - = $ P$ -$ < = F0%߿p߾h߷`߶XߵPߴH߳@߲8߱0߰('x' -(-@P!P#<dc(0 = C!<4cTC$ - = $" -$<<( = 4 -$ = < -$< = 4F -$ = 0- -$@ = 0--߿0߱(߰ '8'-$@$0-@C!C#<dc0C!$@8 =֮@$$$0-< Q%$ =֮@$0-Q% @ ! ="@@ $0-Q% @ ! ="@@=f$Q% =@(-<4$0-!!F!G$b!@ !@$ !*@$b!b<D%b@(-<4< $0-!!F!G$b!@ !I$ !*@$-! !<e%߿@߱8߰0'H'(-(-$ @!#<dB!8 = 0 -(- = < -$ = 0-<6R -$ = 0$ -$ = 0$ -$<` = 4 -$ = 0- -$ = 0- -$ = $ -$<d = 4߿8߲0߱(߰ '@'(-$ @!#<dB!8 = 0 -$ = @- -$ = @-$B"*߿8߲0߱(߰ '@' -( = $ -$ = 4F߿(߰ '0' -( = $ -$$ = F0$߿(߰ '0' -( = $ -$ = 4F ߿(߰ '0' -( = $ -$$ = F0$߿(߰ '0@E! ! '<4@D!D#<dc(C!0 "-E$(-&& =&*@$<d =$$<C%"$B"߿0߱(߰ '8-'8-PH@0( b<@b!b#<dB =@b!@-pV@b`b$Bb(#C!BT$@F0B@ - =< -=(-8@8!:@"@0- ==G8! =< -<4#"! !@C!#@b!e$"#C!@ %#"!$B !=<b<`B0%"#C!T"#$B"C*P@ @-p*@<<4Bi,VP*@< <4Bi*E=$4Bi $=4Bi+AP*@< <4Bi)0=$4Bi(V?$b0B@@; =w@ -=b4Bb"C$b = -@-*` -"<&%< =S;=b0CA$b$@ = -=@-b =@ -=% = @ -="%& = E@ -=% = @ -="%& = @ - =@P --߿X߶PߵHߴ@߳8߲0߱(߰ '`' -@P!P#<dc(C! -0 = $ -$$ = F0$ - = $ -$ = 4FȖ"$<#0B="b< 4B@b߿0߱(߰ '8'8-0-(-@S!S#<dc C!H =@@@D@- C-b!b@; 0-@ -(@(!*@ =nE(!<4! !@C!@b!e$C!@ !$B !=<b<`"0%C!<C$BC*P@ DD 0 , 8 4<$D% =n$0< =$D%$P =[" @-$<<)4<#<` -"@'b$@-< =P@$ =C@ -=8< =@"=_2,4<"D$"<)4$ D =}0E-߿P߰H'X<Bt<db!b!e!+@ -P@$TD$={-+@-'(-80 "@-< =dTX =@{<d0 (-$@-#D = C < =$ -<B $B<" =@P -<B4" < 4$ b<dB"&$P< =vdTh< < =hE(%߿8߲0߱(߰ '@'(-0-$" 8(2"<dT$<dT =$ - =}*߿8߱0߰('@' <f -$80(<"t<  < 8< 4 =$8<f1 -&&0$<"$d<0 <"" =$<fRP@ - =$$<fx - =$&##+@ `0-(-@ -&#d@-2P@# $=4P"0B @2=4P$C0B@0@=2g#0b@" B 0BT@$9 @0bT@$#"H0C0B@#H0b"H =V&$H =7v&$,4 =@P@-``-=4]D 0B@V2@  -(- ==2$=2",$4C#$",$40B@$#"4"@=2<dB@b!b$Bb0B@ =@<<d#<H !$c` @ -<Bb<B$B<#<" =@P"@<(-[ = -0@z$bn`l2<f@ @ -(- ==2$B=3*",$4C#$",$40B@$#"4@D"E P P C$TbP  -@-P"@=3)@V!C$cC0B@ =@<c<<H #"(!$c` @ -<Bb$B<# =@P"@<e[H!E = -0@@R$b`22P@ $"L6-=4%<H$ L(2=3KL 2"0B""( @<H#r+T@`-V#r*T@`- =@P4@(- 0- = ! =@@-=3l4 R# #BY20BT@62@=3-",#4D#$c",#40B@$b#"4-0@=3Į< e)@I!C$cC0B@ =@<c<<H #"(!$c` @ -<Bb<B$B<#<" =@P"@<(-[ = -0@V=3@=3Ұ! -(-@0- ==28- R!r# ",R#",#(` 2@r#@"("4B@=4,"<@!<2@@2@`77 @2" B 0B@-`-"$@)"0B @% =7v&$,@-`$ "HI$0B@#H$h$"H =V&$H4 =@P=4]-0@@  @" B 0B@2 X@2`$2@=4;>@D" 0B@6 =:&$,D 0B@ "@ -$0-$,@ 8- "T%""H0C0B@#H0b"H =V&$H4 =@P`-߿߾߷߶ߵxߴp߳h߲`߱X߰P''0-($2@82 @2 =42@ -=4-$0-$B@ 8-߿@߲8߱0߰('H'@-HXPH 4b@H0B@&, =7 -=44bAH =@ - =7\@-"0C0B@#0b" =V&$j"n"j#n#j$n$j%n% '(/078? - =$ =@P -B 0B@BB@@ 4 =8,' -߿X߲P߱H߰@'`'H-P-@-0-(-48B\# P`$*b@$ (-'\@0-$b@ 8-=5$@,)A@$() @$$$"=5$*$$ =5$*)@ )`&$ $=5$*)P@z$*=5NB$Tbs$ B"Rn$,BT@j$ B@'"H%=5""C$=5"R\$,BT@X$$)@$=5`M$%$,%$L =8EP@E$7=5 B=5"\ B=5"b" P$=6>b "=6>b "$b=6> $ "P=6>b "0=6>b "\=6>b "<=6>b=6$j$J<c(` $a<  <Bl@ $A<  $ =6>D =d/b-d-C/D-?E+@(=8(- @ =(-+` $߿(߰ '0' ( =9- ߿(߰ '0' @@0B@ =8V=8S@=8D@0- =9߿ '(' 0-)8-@@C!$0B@$!P 0b@0b4B =9 -߿ '(' 0-18-$$$D=8CE$HC!$0B@$! 0b@0b4B =9 -߿ '('0-8-@-HP( q -0B@< =d[p"!-`"!=8`-CDB Ed # = E(#Q*@I-b,Bm@$<[ =$@- $<dc "b$Bb&" " =9 $ =;x$@- =90-b% "f =n` -R-5  -BDC!$BD0B@$!BPR QP@@$߿PߵHߴ@߳8߲0߱(߰ 'X'(-@-8-H0` < =d[br@`(-`B!-(-B!#$" %d # = E(#R*@!-``(-"$C!$"$0B@$!"0R 3P@@$߿Hߴ@߳8߲0߱(߰ 'P'0- -(-8-M@0B` b%`( -@ + -Cb -R &P"0B@# "b(!!&#C+@#b =n "C!"B -C!B =O$ =n# -C! =i(# e!(- 0-0B@0#C#=>@(#`8!e*T@ 8#e#0-0B@E#=>8-0-0BT@g*P@8#T'(-H@80 "0B@-" &#S!C+@.be#` "S*@ -=?, -B`-=>b#.be@b$"<(-[ =$@-@"B#<dB@b!b$Bb&B@@B =>@% =;x$@-@B@"0B@ j"n"BB"&CC 0BB"0B"B CC!$BB#< =` -@ - =(-% =@ -@-0-B E$ =nE(!Bp#P!B"#P#@"" P!=?" ==?,@- =E$8?C!@#<"-"\H` --'xP-X-H-x-h-@`-`$ApB0BAC-=E$2<h"<l"B`Bg'A$F@ -(-'0"'(0'4 =S$@-B0B@ (0B@ -(-<;4 ==2$@-4C(#0@$0B@$ & C+@$C$B8 $B$c  $b &=E+b$=E18&$'( =n$"=E18<d\`EF =v$/=E@p`@ -(- 0- =FM8-0b@ -0b@  $BP#,B@ $=ET $BP#,B@ - $B$c =EW$ =<$@-=E$70B@'8$B $ =n&% '( (- =n$&D&% =n$ =@CD d*` @- -B$$7$B =@PB$=EBT@PPBCP$B0c`BB0@ @ - =@P -Bl$BV!Bl(0B@ -Bt$B=EBt- =< --߿߷x߶pߵhߴ`߳X߲P߱H߰@''(-0- -8<h"<l""`"g<d\X@(-$"h$BC! ="h@=E4BB0B@4B0B@"p$B"pE $$ -=E<B4B<" =@B<f1 =E =T,(-=F - =< -=F - =@#$ d*`@-" -$B =<"=F"T@P0"0$B" =@P@ --߿8߲0߱(߰ '@<dcP(-$:<"-"\$b$c0B<"-"\$b$cf(@$c<dBP`'<d<dB\ $<"$<"<dB<"(<dB4<"$<"L< N< M =A ߿ '('0- -8-@(0B@-< =d\ "40B@ =< -"40B@$3$A=F`-BL$BBLBlC!Blf$ E< =vd\ =< -=F$/ =@<f1 <c(<,d*` @-<B0$B<"0 =< - =@P` -=F$7<B$T@P0"<c0$B"$b%<# =@BBD$BBDBh` -C! =@PBh-߿@߳8߲0߱(߰ 'H$P-< 4Bi 8-4B C$b<dB=FѬ$-@ !Bb$`=Fӌ=F-@ !B$@!B$@=F䌥=F-'`-0$$(-phXPH@8("3 @" # !Bb$`=G11"A" (!!S0!+@ b#$+@$" 0B@[ -"T@@-=G - @-#`" V0!+@ v8!$d&C$@$$+@(!1 -12@4$ =(-@-< e)pi!B(!S8!+@ 0-$$C$+@$<dp =F (-@-CC  - 0# =(!@=G-R@$)-߿p߾h߷`߶XߵPߴH߳@߲8߱0߰('x0$b (à"$$$($ # '8-@-H-PX0( q =F-@0- p!P(!q !D+@ $C&RC$D+@$=G-S#Dd&`(C`$-`-  B!BC$@-=GE+@` - =G0-# $ C!c@0-d$T`&& B!BC$T@=G-߿X߶PߵHߴ@߳8߲0߱(߰ '`'8-HP@0(S-<B =FӌES`>@-@ -% =`0-@9 -$P$ =$@-  -=HU- =$P&00@ -(- =n`0-- -<B' E =G 8-@-0!!+@ #$C#&+@#8@ $$<"hd$P@'C`$'" -߿PߴH߳@߲8߱0߰('X'`-H-X-(-0-h-P-p@8<BȌE =F -@- -% =0-@  - =H(-@- =I2-"4 ' -(-' =G8-@- @`-bT`-s`$-Sw bb 0Bb t"brBQ# 'Q#a$"@0b*@,"@)<B@@-<"=H$$ =$@- - =$""P=H߮0"@ @-C*P@P&P QBC*@M`-w@-2BC*@V6@-00!<@+g*T@&*@T*@(-  -C+@ $$+@&<B@@-<"=I$$ =$@- - =$#`-0=I2P `-$c =I2P< =vd\`-߿p߾h߷`߶XߵPߴH߳@߲8߱0߰('x'(-8- -(-XPH@ =F0@-- &@W@-" !E 0# =(!@-U` <BȌE =F` -S =IjR@-BSC`5F2 -C <d\=I<B<&=I $BA C"'C*@ -1"C*@V - (-$<d] =vB 0B@=J0-Q3V--"TR00&jBnBjC nC'jD(nD/Cb&QTQppP=J)P` bR@-``B=J)b< =vd]H=J*@-00#bTQpp&P'&P@ (-$T$"=J $BA <BЮ<&=J<d]h<d]x =v8-`0-&P0@-jBnBjC nC'jD(nD/""##$$"Q"QCbTPqq@-C D#0c0C D#߿X߶PߵHߴ@߳8߲0߱(߰ '`'(-0-@8 "@O-$T$ =$@- -=J- =$T<d@(-& =G0D&(-@- =N-$" 0B@ -< =d^4@0B`4b@$(-@ 0-<BĆ6$B<"` =LO -=N-S$=N-$0@,4D0B =M6, =L(-@-`=N-$3,@$B4B=M$Bu$x$C$4B=Mb!$Q -$ =$@- -=N-$7 = (-&t - (- =N<0-=M - - =n (- -(-F =H]8-@-V @ - =$=N-$c 64<" $C$4B=Nb(!$E,0 =n$$ hCLlCShDTlD[hE\lEchFdlFkLST[\cdkCllb@0-$@ (-6$B6 =@P4-߿߾߷x߶pߵhߴ`߳X߲P߱H߰@''8- - $$@!d(!$$+@ $=NW@-$$b$$+@+@ =(#߿ '('@-X-P-H-2b`@80=Nr0"0B@$$40B@ $6@-(B@$b =LO=N 6 $% -2b@  -"@ - =;$@- -P & =N<(- - =K(-@ -P -6@$Bq 6@2b =$@<=Q$7<0B@< =d^0<.BDT@ $ BVB$@ -$ =$@-`G(-@0-< ==`8-c$b&pD=Q$+<B4Bbb0B@gr!bD@L&cE$B4B=Ob!&pHb0B@ +@ -@&$B4B=Ob!&b0B@ +@ @T&$B4B=Ob!&b0B@+@-@&$B4B=Ob!& -$ =H$@-R $7% = -T@$76 b0B@ +@ \@&$B4B=Ob!\%b0B @+T@db$C,b@<"-"^@@$=Q$0-LTc'0, =M:$@-0&e d =Q$L0b6vD$B=Qb6$LbT0-, =M:$=Q@-L =K(-@- $cb'(b LL =@=Q$@ TQb$; =T@=Q$;c$b (b@$b=Q$bA=Q L@$B4B=Pc$RE$Hb4Cc0 $@&C$B4B=Pqb!&Rb=Pu4Bb$b T@&C$B4B=Pb!&Rb=P4Bb$C$bD $@&C$B4B=Pb!&Rb=P4BbC$bb0B0@0D-C-D-C-D-?#BC!b##@C!<dc C!(--"C($(@&1(P@- H" 0B@D&P -&E =n$&$(- =n$&P -&E =n$'D(- =n$$B$$$=UsB &Db0B @ '2 -(-<;4 ==2$L&D'2 =n$` -(-'00-$>$10b,@ 8-L ` -L0- $B,@ 8-=U =< -߿߾߷߶ߵߴx߳p߲h߱`߰X'' -0 =@( @- =< - =@P߿0߱(߰ '8<B'@-8$0-H@ (<dL($<(<" = (-d(-D-C-D-C-D-d?#BC!b# #@D!<dc C! @0B@$ C*@`--(@&  -=U- =U --d$C D߿H߳@߲8߱0߰('P'8-0-$PH@(#""$b -"@=V$/ =@@-$(-D-C-D-C-D-$?#BC!b##@C!<dc C!D($(@&(P@-<$4BiB =@P` -=V$ =B -@<$ =@P` -=V$34Bi B3R*@<$<$4BiB =V4BiB,<$4Bi&B*&=V&$& =U@ -@- " 0B@&$ =U@ -@ =U - =@P` -=V$1 =U@ -&$& =n$" 0B4B=V =U -=V&&% =n$ " =@P` --߿PߴH߳@߲8߱0߰('X'0-<8<=V4,=V8'<$C$4< $$ E$C4$%  -' =v$-߿8߰0'@'<=V<<$C<=V<$E-=Vb,=V$$<c`($b c4`-'' -=W0-<< $=W<<$C<< $=W<$F$$ $=W$b#=W<cP` $b f,c4`$$d+@b@$$cd+@''0-<<($<4B=W: $<$C<<($=W:0$E$=WD-b,'=WD$($0<c`-b c4`-'<B_8@<-$ $PC$4-=We< -,($PC$4-<$PC -< $$$=Wu-$'8-X-@-0-P-H-@ `<<  PR< 4< 4Bi"(Q*@< < 4Bi"7Q*@< 4Bi "2$-=Yd4Bi"u< 4Bi"*$-=Yd4Bi#Q*@ < 4Bi!"*@l<@4Bi"$-=Yd4Bi%"d=Yd$-c$b <  4Bi R -@- -<dc b$B=_b(-  Q#q!`- =ZF @<dc =^M Q!q# c,b@<dB b!b$Bbcd,b@<"-"`@(@4$=^@.$(@/$=^@.$+$=^@.$'$.$@ b0C$B*@,b@<dc b$B=_bb<dLb<b-c@C!<"-"_@$@ &f=_ -<dc =^=^`.@U$ =_bb =^b =V@$ =_@-`$d< =V =W@-'0(- =V@0-0 $=^b* @t - =_@-`m$bb\b @ b D0@0@bL <d Q!$Bc$d!b -$B =_b=_.$@b0B$B*@<dc b$B=_b <flb<f\$T&d =V'8@(- =V0-<f1L8<fx"d =V(-&2@ -&0-$&$ =Lt,$b@(-=_"<eL% -0-$c&$, =Lt$(- =? -<d`<dBL $FC<dB\$G =JC=_ =< -߿߷x߶pߵhߴ`߳X߲P߱H߰@''P-0-h`XH@8( < 0B$U< B0B@L4 =_@ -<<$P =d&@-@ $ =<$@-@-$C B@)`-$$Dc`$g$p0+@~` -Tw 0#` -B E0- =nE(!BP!B0# p!C0b@B C!@B$BB<U#4cC$<C%U#0c`U#& !& =n$ - =_@(-@ =$@- <B ,$B<" ,=`r0 0B.B@<dc 0=`"R*@  - =>@(-@- <dc 0=a,0  - =ZF@(- 0B@<dc $=`*@<dc 4=`#e*@*<dc (b$B=ab@ "C -%=`" =>U(#< .B@ =b -@<c`b<D+b B0B@ bLD#b0 b(b c4`$b`<Ba0@  -<dc Hb$B =$@- <dc ,b$B=`rb0 <dB EP(-@0-   b b b(-R#0c `$`@<dc 8b -$B =ab@- $<B `$B<" `=av$ =b] -=avR#<dc Tb$Bb <b-c -@C!<"-"_@ @(-=`r =< -=`r߿8߲0߱(߰ '@'H-@-$8$P0(B C0 D!d#B `$C$ =;$ @(- <d =` -$U=bp  b*@ sbcC!D# "*@i$ $ =>U (-Q!q#$b!*@e#@-"*T@$  =< $ =b =b| -p -QF- "!B@>-p $$E@ - =>&@ $($ =>&@ -($t b b` - =$ =#,b@` -$ 0-=e<8-$b"< <fR $#<B b!$@$6@-(B@$b =LO -=d6< $B$<f B" - =K߮B-` -$=e;$$@"$$B = "` -(-@0- ==2$#$c#4<C$<C$=e$@,$E- $C&,U` -(-<d =eJ$@ -<dc Hb$B=e!b<dc Db$Bb' =< -=e><B L$B<" L,B@<"-"a`@$=e8$$<dc lb$$B=e8b$- -(-0-8- =]:߿p߾h߷`߶XߵPߴH߳@߲8߱0߰('x'8---$-xDL =f'8@-8LD2 1@<4c<B<C$<@C%BCB4D0B@B$Le$<" 0Bb%=eC<d XB0B$cL'  - =$&T40B@Bb 6@-(B@$b =LO=e6@T$"$"B"D1@ =A鏤T@ - =VŎD =Z@ -@ -=f$3 =e@ =K -@=f$AC8$cC8D@4^<0c`0TB @U(#BL -P@ 4B =ZFB=fæB 5  -,T@  (-=f@- =< --' -D1"@- 6@-(B@$b =LO=f-6=f- =< -=f' ߿߾߷߶ߵߴ߲߳߱߰x'' -@H80(  $R#4C!C+@'-bT@"0B@$ R#&b+P@2 -<[ =$@(- $<dcb$Bb$ =g!$ =;$@(- -=gP-$R! $B$c - <c&B(! =n =gF&d$  R!r! =&d @0- =n&%&B#-r!#߿Hߴ@߳8߲0߱(߰ 'P'@-8$PH0( 0B$Q &$c`&Bu$p0*T@ -0bP@0#` -@(- =n0-P!0# p!&BT#2@-@&2@&R-߿PߵHߴ@߳8߲0߱(߰ 'X'8t@-0H( h-E$T-D&$P =h,(-=h$@4*B@2*BT@1$$Tb-$ &GP,@'<"-"bh@=gޢ0==gޢ0D"84B=gޮ"8"8=g$"84B=gޮ"8"8=g$$"84B=gޮ"8"8C$=gޮ"8$E- =@ -@-@<B t$B<" t=k P !qq q*@@ -<dc |=k =>U#(#<Bjnjn078?@@ b@@ -<dc xb$B=k b<Bb@b@@ -b&% =ZF b0B@@ -<dc xb$B=k b<1b#b #bb #  b#bfc$,$ <d =]@- <1<dc b$Bb #<dB C$cCB0B@$<B $B<" =kk0o7k8o?@@ -$T! =]:=k b<"ʎ <"̎#80b@0b@$& =k$H&<d@0-BC T#BBt!C T#B$H =8$,@$ =7$,=k <dc b$Bb =<@ -H =<߿xߴp߳h߲`߱X߰P'' -0-8-$$@ =;(@-  -@0-0 &R =n&  -R=k.-߿@߳8߲0߱(߰ 'H' -(E$ =7$, =7$L߿(߰ '0'8@--@#8-<H-BaH@0-0B!FC<dBԯ,4$ <d =kk<d <<dBԯ$,4 =\~߿8'@'0-(-@ -XPH8 3- =<B V@t$8 =@@ -(- =[@-@- =@P -=kB @d$9#0b@ -0b@ " $BQ#,B@ $=k" $BQ#,B@ -" #$B$c" =k#$ =<0-@- "0B@"$B"0 <b$ &b B B B C  - =ZF&e0B@&b4&bBDB=<dc b -$BbB&F$GEP =eJ00 @- =\&@ -V =@P -=k- =< --߿X߶PߵHߴ@߳8߲0߱(߰ '`'8-H-@-0P$ X( p-(-0- =Ww8-=l,Tw$,@q<"-"c@m$ =@@-<d =[` -@- =@P -@a<b<b =7` -@-@Xc<Bb=lbD =@@- - =[(-@- =@P -=l @E$8 =@@- - =[(-@- =@P -@: =6n` -=l @=l$9 =@@- =\& - - =@Pb0B=lb =7R` -=l -(-0- =kp8-=l =6` - =l -=l - =\N(-=l - =\f(-=l=l-=l$-=l$-< =db< =vdb =< -@- =< -@-߿X߶PߵHߴ@߳8߲0߱(߰ '`' -0 =@(<c@-<dB <" =\4 - =@P -߿0߱(߰ '8'8-$ '$"@:-(B!@$@--$$P@$F$@P@$=l$$(B!P@$@$$(d@-' $0b$ $ob$(bp@$nb $ =m#$tb$ $xTb$ $=m$$-'p-`-h-$xB%X - ={$.@-0#(@' =| (-'8' =m&$@& - ={$.@8-'@(- =m&$@$ߣ8ߤ@8d-=m~c=m~-`"#@# -<(?$b,B @=mr$C$b,B@=mr$C$b,B@$Cr*@<? -&1"#@d$߿x߳p߲h߱`߰X''(--0L@ - =m 'L' L =m&@(-@$=m-ߣ <?߿0߰('8' --(D@ - =m 'D -D =m&@(-߿(߰ '0'X-$?`PH@-$0C=m@$@-$ '$E$-'  (,b @$b=m$g0,BT@$gW$&' 0!@<dcX =z -- ={ -$C` P!q !@(-&$$ca$P!@@-߿`߲X߱P߰H'h'xx-$?ph@-$0C=nJ@$ @-<?4<C$@$ '$E$-' <?F (<(?<?,b @$b=n,$g0,BT@$gW$&' 0!@<dcX =z -- ={ -$C` P!q !@(-&$$ca$P!@@-߿߲x߱p߰h''@--$b0B,B @A=ni$$b0B,B@$$b0B,B@$=no-@%$$$''0-@-8-H =qB@$-=ny&b$+=n$b =n&Q!@$b,B @ $B"!&@V@# -߿H߲@߱8߰0'P$$BC$B'8-(-0-@`l 2j2+@6@-%0B@&0BT@`-.b@2=n`-$C#p#B&R&" $<B@<B@5-<D<C-BD!<#-"$c<C-B@<B@"-<f ={@ -@&@&1Q! <D-B@$<D-B@ $$<$-#<$- =v&"$߿8߲0߱(߰ '@'(-<d0 ='0߿ '('( ' =P$߿('0' &<d0 =w &߿ '(',@ ,@ =w0=w- =xC߿ '('(-`-@-X-hPH80 C'T#!+H@&)! - @(-@-@ - `(- @- - `(-A  -=wd`-@- - `(-@ -`-  -B$&E&RT#-=ww - @(-@S+4!2+@ -=wS+ `(-@=wt#24!`-=wt#S+@@ -2@- - -t# -%b$"&1e$c-=ww$`-=w@-- -=x/(-Q#T $<A #$V*@@T!*@*@ -(-0- =w08-=w?-@*$@ -T! - @(-A* -B$&E&R=w*(-0- =xC8-*@*@[$ -4! -  (-AS -"$&%&1=x7=x/(-=w?-*@* -(-0- =w08-=x5@-@*$ -4! -  (-A* -"$&%&1=x*(-0- =xC8-*@*@$@ -T! - @(-A -B$&E&R=x7(-0- =xC8-=x7@-=w?-߿h߾`߷X߶PߵHߴ@߳8߲0߱(߰ 'p'0-8-(r!H-XP@@h!4+@+ $2#+T@ ! - (-C!#+@ -!0&E4+$2#&p+@ -b` -#p+@$&1=x}4+2!4+@2#߿X߶PߵHߴ@߳8߲0߱(߰ '`<A<B4cNmC $09<"0B<$' ( =x-&PB$B߿(߰ '0'(-(0@ =^=x$8D! <d-c$b-<dB! q!+T@# - 0- =v(! -b!߿0߱(߰ '8'(-<d =x'0߿ '(' =x'8߿ '(' =y '8߿ '('-(-0-' $8 =o@0-@' (- =y  0-=y$߿8߱0߰('@'pH-@-`-X-p-xhP @-$l$L"@- =qB@$%=y&&b=yU&<dc ={.@"$*g`-=yT$P~&w$B0B,B @- =q6@' =yE&@(- =|0#' ' =m$ &&@.$s$c$ =qB@=y]&1 @ <dc ={? -=ys  @$ `&$b$$td =| (- =y"!< ={dc@< =qB$@$d=y&1b$ub$x=y$ b$o=y$b$b=y$Pb$ @'  =qB@<dc ={? -=y ={ -Q# '  =| (- ` "!&$b$$td' =m0-R`&- =y&$ =qB@=y&1"b-&&1@O-߿߾߷x߶pߵhߴ`߳X߲P߱H߰@'' ='8߿ '('8-(-0- --@<C-B$@$&*@$c$R--R -<dc ={ -@=z-<dc ={ -@=z$<dc ={ -T@$` -@(- =v0-@ -$ <dB <#-$ $<#-$$=z/b!-߿@߳8߲0߱(߰ 'H' -( ={ -@-$b,B@$b=zQ$,B>@$^b-=zQ0-߿(߰ '0'0-(- 8 ={-@(-$*P@$ %#=z$"%#=z 2@ - ={$ &1 @ -=z%#(<dc =z@ -&!=zz%# @ - ={$0&1 @ -=zC!C!"#<dc =z@ -& @ - ={$ &1 @ -߿8߲0߱(߰ '@'<dc< e)d@(8-.-bE!$cb@$!B@'!G`0-FPH$TC$$T$=z-$@-'' =z-F$$@,B''-@ 0-$T@$=z$$T@-'' -(-0 ={!-q={`-߿0߱(߰ '8'={,-@ .E-$@-'- $$@$b@$c-@@- 0--bG!$cb@$!B@$@%- -@-bb$cb@-'(-0 ={ =qZ@ -@- - ={. (--߿0߱(߰ '8'0- 8={$={- =qB&@&T@&$߿8߰0'@'={-$C$@,B'-@ -$cbT@$c={d+bb$cd+@-'8-@-H 0@ ={- =h&D =h@-&1&R"$T@&B,B߿H߲@߱8߰0'P'0-(- -8 ={ @-@ -&R%&1 ={&@ -߿8߲0߱(߰ '@ -@-$@$c`--b`$$$=|-b#' 8-=|P $$$@-''h`XPHW@U' '!$=|6 C&R@$$B$ޢ@=|B"$#@&1' $"  @3' $*$?#`+t&1"@  -C $*S' &P@ (-C'  (- =|0#-@ - =|' @-"- ={' =|y!Ps&1Bb-&1&RB@B@"@=|$=|-C`-$$*",B߿hߴ`߳X߲P߱H߰@'p'0-8-=|@ - ={.P@&=|-T@.-߿@߱8߰0'H'0-&8%- ={ -=|!@-8-TG& -@ 0-b$@$@-&@-߿8߰0'@' -(-0=|-=|- ={ -@-`.p !E$ca$-߿0߱(߰ '8'0-8-(-PH@ ={ $BB!P+@-$($)=}&1P &1 ={` -P@&V &=}!-&P+@-߿PߵHߴ@߳8߲0߱(߰ 'X' -(<$< =T(-<c(-b! ={? -@!=}H-<#b@$b<"`-߿(߰ '0'0- 8=}W =h&&@&߿8߰0'@' =}߿ '(' PH@80(<D-B@-=}$<D-B@-@ - <`0-=}<D-Bb!<dB `b!$ - =}B*0B@@ -T =}$ @ -& =}&13*@ -߿PߴH߳@߲8߱0߰('X' -0(@- =}@@ @ $@$ =}=} =}><f0@ $@$>@ >߿0߱(߰ '8<B '0<fR @8(@L $&Q%&"@ $P@@&1H%&"@ $# 0c `@(-0"&0B@"( - =$=}# 0b@0b@BT@ܮ@"1=}S"0=}@$b# =* @" 0B@" @@ -3 =}$=}"@&RH<B@ =@߿@߳8߲0߱(߰ 'H' -@80(<C-B@-<#-#`C!<dc C!$, @<"-"d0@j"(n"/j#0n#7j$8n$?j%@n%Gbbccddee=!- =$@g",G$% "&@ 0@$jbnbjcncjdndjene"("/#0#7$8$?%@%G=!- =}"B= b= 3"= b"(<dd4B` <(ɦ"(<dd( =@ -@"(=~0B"(4B"($"*$$".$ "5$"2$"9$#0#6= "8`j"(n"/j#0n#7j$8n$?j%@n%Gbbccddee".$#40B= ".`j"(n"/j#0n#7j$8n$?j%@n%Gbbccddee".$#40B= ".`"$@.$% ={.` -=!-<B@"-<f ={` -@&@&R<C-BP@$" <C-B= "$<(-$ ={.` -=!&=!$-߿@߳8߲0߱(߰ 'H'' <dd``XPH@80 ={.(<B0@d-$--*b@_-<dB !<dB0! @$0-@ 8- =ݮ$@"< 0-=) <(-<#-"A$=2$<#-"$<#-"<$Bb%@-߿Hߴ@߳8߲0߱(߰ 'P'(- 0<P-BP@-< - ' $08,B#0C2$P$K$P$n$P$$P$$P$$P$,$P$X$ P$$ P$$ P$ `0$ P$$ P$%$P$K$P4߿@`-'H'$ (@$ $ =<$$$$=<<dd =v$ =<-< =vdd=<-< =vdd=<-< =vdd-߿ '('$ (@$ $=e$$$$=e<dd =v$=e-< =vdd=e-< =vdd=e-< =vdd-߿ '(' ( =q9-@&-߿(߰ '0' -0-<d0 =@(-߿ '(' - - -@ - ={ @-@ - ={$%@@!. @' =qZ -@-  -@(- =0-@- - =o`(- =q -=-<d=@(- =0-@-' =o`(--߿ ߴ ߳ ߲ ߱ ߰ ' ' ---@ܯ\$%THѢC&-----=d<dd ={.@?$-b` -=$$0b$~=$b$*=$Tb $&b$H$V=$S$H$W=$S0B,B @- =q6@'(=& (- =|0#'P'( =m$ P=&P=&$.Pb$&T@.$%h$sC&R=@b$c&b$H$E$S ={.@ -=<de ={.@ -=b $l&b$H$CPC@P`R$S=&Rb&C$d&< ={de@1$db$u=g$b$x=g$ b$Xb$o=g$b$b=g$Pb$d &b$H$$S@ -E =m0-=z$H$$S@ -E =m0-$Xb =}L@ -=< ={de@ &b$H$$S@@ -$-D% =8-V!@@ -(- =zU0-BT@&R=&&&R@'@\H#߿߾߷߶ߵߴ߲߳߱߰'<C$C&+'pDPX-`-hH =F @F42E<de ={.@ -=DF <E<de ={.@ -=<de0 ={.@ -= *"(=$P@$''1F  (-'8'1`8-1$ =,1`@0-'28@@-&$!@@ -(- =v$߿h߳`߲X߱P߰H״p'xD'P`hX-x-p--PHF `<E@$-=,F c =u'0F ׬0D&sF `2`-E&F <5e@<6eHF5c =u'0F6@F5B8F  D$B0&׬0@F7`2$BEﯢ@&,b#@Y<"-"eP@@@ &+@ &"+@&1=g$0"&1@$."&1DF 2E%&R@<6eF FF6'8 =u&Rס8F F  D$B0"@&1F52EF6DF 2EF (-`0-&'$ =,@-&R$B$0#&RB&1=3#@@$&"@&1$."&1&+@&R"@&1@&+@ '@`0-D&',F  =$@-@$B=䯢@DF 2EF <5e$@F5 =u'8ס8F62EF @=$BF  D=$B0$0"@&1$."&1DF 2E%&R@<6eF FF6'8 =u&Rס8F F  D$B0"@&1F52EF6DF 2EF '@`0-&'$ =,@-&R$B$0#&RB&1q+@$0&1"Cq+T@&1#$.Pb&1&1@0- = -=@-R@$@C*T@&RT`&DF 2E < eF <E&R&=$@@ &+@ &R&"+@&1=U$0"&1@$$."=\&1-DF 2E:@/<6fF FF6 =u'8ס8F D$B0"ס8F52F E&1@P@F6&R@D<5fF62E '8F5 =u&Rס8F F  D$B0"@&1DF 2EF (-`0-&'$ =,@- q+@$0&1"Cq+T@&1#$.Tb&13#߿߷߶xߵpߴh߳`߲X߱P߰H׷׶׵״''Dt@|F `F8-0-(F 2-E H<,fF,  =u' ="B$B=B$BDF! ס < fF!<E$.$0$1PD&$B(B:T@ -@$1%=&1=&c$-b -$.$0PD&TC -R`=& -߿H߳@߲8߱0߰('P'8-$(#=$-$+$( @*'$ < ?xd-8b-8b-8b-xd-?b#C!@#$B0`(-( @$$0'+@-$+@$=N-$0$$0$-''(@ =X- =}f߿ '( (08@HP-ܐܑܒܓܔ ܕ(ܖ0ܗ8ܞ@ܝHܟP-<& F `F&E<&F&F F"`DD<d!` <d!, <d! <d! <d! <d!( <d!  @K   $$# #K##'(@' =Ӭ =x$@$ ߿('0' =߿ '('(-( $$@< =vdf =- =qZ$P@-P@@߿(߰ '0' -0(b-< =}_dfHbC!D$!Q$B߿0߱(߰ '8' -(@< =}_dfP@$!$Bd$߿(߰ '0$(@$$=F$=F$=F=Fb#*@-E!C$!B@@- 0--bG!$cb@$!B@$@%-